CAZyme Information: MGYG000000057_03180

Basic Information

• Species: Bacteroides sp002491635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp002491635
• CAZyme ID: MGYG000000057_03180
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
737		81041.6	6.3836

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000057	4370351	Isolate	United Kingdom	Europe

• Gene Location: Start: 19543; End: 21756 Strand: +

Full Sequence      

MKNKFFVTLLLACSISTVSAQTPVYMDDAQPIEARVKDALSRMTLEEKVALCHAQSKFSS
AGVPRLGIPELWMSDGPHGVRAEINWNDWGYANWTNDSITAFPALTCLAATWNPDMSAKY
GKVIGEEARYREKDVLLGPGVNIYRTPMNGRNFEYMGEDPYLASVMCVPYIQELQKNGVA
ACVKHYALNNQELWRGHIDVNLSDRALYEIYLPAFKAAVEEGGVWSIMGAYNKIRGQHAC
HNDFALNKILKDDWKFDGCVVTDWGGAHDTYEAAVNGLDIEMGSYTNGLTSESAFTYNDY
YLANPYLRMLKDGKVPMSTIDDKASRILRLIFRTAMNRQKPYGSVATEEHYAAAREIGNE
GIVLLKNAPVIKKGAPLLPIDAAKYQNILVVGDNAVRLLNQGGGSSELKVKDMVSPLDGL
RAAYGDKVTYAKGYAAGRPMYGRADEISQNVVDSLRVEAVEMARKADLVVLVGGLNKNHF
QDCEGGDRLEYGLPFGQDELVEALLGVNKNLVLVLLSGNAVEMPWVSRVPAIVQGWYLGS
MGGKSLADILSGAVNPSGKLPFSFPAKLTDCGAHAFDELSYPGDSIKQEYKEDILVGYRW
HDTKKTPALFPFGHGLSYTTFTYGKPVLSAKTMTADGTLTVTVAVKNTGSVAGKEIVQLY
VGDDKCSVLRPVKELKRFAKIALAPGEEKNVTFTLTPDDLKYYDEISATWKYEPGKFKAY
VCASSADVRGVVPFEMK

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	61	282	1.4e-65	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.68e-113	1	729	1	758	beta-glucosidase BglX.
COG1472	BglX	2.81e-69	64	432	56	395	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.31e-68	5	697	9	744	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	3.46e-58	362	618	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	4.03e-37	65	330	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK86688.1	0.0	1	737	1	737
QUT61320.1	0.0	1	737	1	737
QQA29800.1	0.0	1	737	1	737
AGU13700.1	0.0	1	737	1	737
QPH58998.1	0.0	1	737	1	737

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	4.49e-153	36	728	5	660	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.11e-122	39	731	8	658	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	7.37e-111	16	730	33	822	CrystalStructure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
2X40_A	2.79e-106	35	729	3	706	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	4.12e-105	35	729	3	706	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS8	0.0	14	735	24	744	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P14002	2.46e-152	36	728	5	660	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
P27034	1.45e-136	36	736	2	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
E7CY69	1.02e-120	43	732	12	668	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	1.44e-120	43	732	12	668	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000552	0.982566	0.016134	0.000274	0.000236	0.000215

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000057_03180.