CAZyme Information: MGYG000000057_03351

Basic Information

• Species: Bacteroides sp002491635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp002491635
• CAZyme ID: MGYG000000057_03351
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	MGYG000000057_45|CGC1	42318.36	6.0486

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000057	4370351	Isolate	United Kingdom	Europe

• Gene Location: Start: 9950; End: 11077 Strand: -

Full Sequence      

MKVAFIGVGYRGRQLLRLLQHLPAFKVVALADPGLDDSGFPGIGCYNHGEDDYLNMLAEH
APELVFVASPWQCHVRHALCCVERGCHVALEIKGGLYIDEYRPLIELAHRRGCRVYPLEN
TLFMRENLSVCNMVAAGLLGEIVYMRGGYRHDLRRLLLDDAGNIGNREKTESVWRSKFYQ
EENGDLYPTHGLAPLCMMAGINRKDRVKSLTSFASKAAGIYQYIKDLGGNTDVKVRLGDV
VVTQLETENGILISLTHDTTLPRPRSLDFEVQGTKGIWQGDRRMIYIEGLSPDETWEADG
AYVDRYEHIYWQQWGSDALKVDTHHQGMDYIMLKALEADLKDEISFPATLSDLALWTSVT
PWSKLSIAEGRKVDL

Enzyme Prediction     

No EC number prediction in MGYG000000057_03351.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	2	372	9.8e-110	0.9448621553884712

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.09e-16	1	375	4	340	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	2.85e-10	1	115	1	116	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV42950.1	3.73e-238	1	375	10	384
QUT33801.1	1.29e-232	1	375	4	378
QQA30653.1	1.29e-232	1	375	4	378
QUT62197.1	1.29e-232	1	375	4	378
QRO24037.1	4.69e-165	1	375	4	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	2.58e-85	1	374	21	421	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	1.24e-42	1	370	43	424	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	1.41e-84	1	374	21	421	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
B2FLK4	9.34e-75	1	370	34	427	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A6LB54	2.01e-69	1	370	50	443	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4Q8G1	1.77e-67	1	373	53	448	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A4FN60	9.43e-60	1	358	61	420	Glycosyl hydrolase family 109 protein OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=SACE_6314 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000057_03351.