CAZyme Information: MGYG000000058_00487

Basic Information

• Species: Eubacterium_I sp900066595
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_I; Eubacterium_I sp900066595
• CAZyme ID: MGYG000000058_00487
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
809		89960.98	8.4646

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000058	3448185	Isolate	United Kingdom	Europe

• Gene Location: Start: 547270; End: 549699 Strand: +

Full Sequence      

MEPEEILGQLTLEEKAALLSGKTMWQTRDIKRLDIPSVFCADGPHGLRRQGKQGDYLGIR
TSLPATCFPTASAVANSWDETLAEEIGTALGEEAVLQDVQILLGPGLNIKRNPLCGRNFE
YFSEDPCLSGKMAAAYVRGIQKKGVYACIKHFAVNNQECRRMSVNAVVDERTLREIYLTG
FEIAVKEGKAKAVMTSYNRVNGAYANENEHLLREILRKEWGFSGIVITDWGGSNDHVKGT
KAGSNLEMPASGLSSAKELVEAVENGSLKEEVLDQRVLELLRAVLDLKSKKQKTGDLYSQ
KAHHRLARKAAAQSCVLLKNENHLLPLKIGCKAAVIGDFAFSPRYQGAGSSLVRPVLLDT
PKDELFLSGLKTAWAHGYLRNGKSSRKLEQEALKAAAGADVVLYFFGLTEASESEALDRS
HMRVPQNQIDLLYKLSEVNSHIVGILSGGSAVEAPWESCCEAILYGGLLGEAGGGAVADL
ITGRVNPSGKLSETYPVCYKDCPSYSYFPGTGKNSEYREGIYTGYRYYETAGIPVRYPFG
FGLSYTDFAYSDLSLSQEGATFCLKNAGCFDGAETAQLYIGRKDSQIFRPAKELKGFQKV
FLKAGETKQITLFFDDKTFRYWNVKTNSWEVEGGRYQIMIGSDVLDIRLMAELEVKGTTK
LFPYQREEMENYYKGAAAQISKEEFECLLGYPVPDGVWQEPLERNDTVSQMIYARNRGAR
FVCRCLIRLINRRQRLGKPGLNILFIYNMTFRSMAKLTGGFINMEMAEGLVQIVNGQVLK
GIRNVVSAFLRKQKTEKQYRKILEKGQGR

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	29	249	3.3e-69	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.70e-87	26	648	95	758	beta-glucosidase BglX.
COG1472	BglX	1.56e-69	1	340	1	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	3.65e-58	10	615	60	743	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	2.47e-42	32	283	63	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	1.04e-39	316	545	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SEU00071.1	0.0	1	803	1	804
QQR02742.1	0.0	1	803	1	808
ANU50590.1	0.0	1	803	1	808
QBE98345.1	0.0	1	808	1	809
QJU18245.1	0.0	1	803	1	808

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.69e-215	4	661	6	674	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	6.66e-182	7	663	9	671	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.40e-131	5	655	6	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	3.64e-130	5	655	6	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	9.18e-96	4	675	7	844	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	9.27e-215	4	661	6	674	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	1.66e-171	10	663	12	680	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	1.85e-170	10	663	12	680	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	1.00e-125	4	648	47	738	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q5BFG8	5.35e-116	4	653	12	836	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000058_00487.