CAZyme Information: MGYG000000060_00338

Basic Information

• Species: Lachnospira eligens_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira eligens_A
• CAZyme ID: MGYG000000060_00338
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313	MGYG000000060_1|CGC4	35230.19	4.6581

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000060	3236509	Isolate	United Kingdom	Europe

• Gene Location: Start: 344072; End: 345013 Strand: +

Full Sequence      

MITVAKDNSGDFDSIQKAVDSVSDNNNETIFIKKGIYKERIEIRKNNITLIGEDTDETII
TEGFYARMIMPDGSKRGTFRSYTFLVYADNFSASNITFENSAGFGDDVGQAIAVYAEGDN
ITFKHCKILGHQDTLFTGPLPLKEKQPGGFTGPTIDSERKLVHQLYEDCFICGEIDFIFG
SATAYFKNCTLFALNRNEPINSYYTAPSTYEGQAFGYVFDNCTFTGNCPPKSVALSRPWR
IHAKVVLLNCEYSDQIIDEGFTDWNKPESHESVYYAEYNGHGDGYKPEKRAAYVHQLDEA
QAAFYNIENVMHS

Enzyme Prediction     

No EC number prediction in MGYG000000060_00338.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	2	311	1.5e-89	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	9.27e-77	1	310	83	401	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	3.40e-57	2	302	2	286	Pectinesterase.
PLN02773	PLN02773	6.84e-52	1	313	6	294	pectinesterase
PLN02432	PLN02432	3.67e-50	1	303	12	278	putative pectinesterase
PLN02682	PLN02682	8.35e-49	2	302	71	352	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR72174.1	1.37e-202	1	313	1	313
ADZ82949.1	9.77e-106	4	311	3	312
QEH68466.1	2.78e-105	4	311	3	312
SET76962.1	6.21e-104	1	311	1	313
QOV20146.1	4.24e-101	1	311	1	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UW0_A	4.26e-33	11	254	43	282	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	7.83e-29	30	311	37	334	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1XG2_A	9.63e-27	4	290	7	274	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.92e-26	2	284	9	272	Pectinmethylesterase from Carrot [Daucus carota]
1QJV_A	7.08e-25	30	311	37	334	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	8.79e-35	1	305	6	290	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
O22149	1.44e-34	4	284	209	465	Probable pectinesterase/pectinesterase inhibitor 17 OS=Arabidopsis thaliana OX=3702 GN=PME17 PE=2 SV=2
O23038	7.33e-34	2	303	91	374	Probable pectinesterase 8 OS=Arabidopsis thaliana OX=3702 GN=PME8 PE=2 SV=2
Q43062	1.11e-33	4	284	211	473	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1
Q43043	1.98e-33	3	290	60	329	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999808	0.000212	0.000006	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000060_00338.