CAZyme Information: MGYG000000060_00409

Basic Information

• Species: Lachnospira eligens_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira eligens_A
• CAZyme ID: MGYG000000060_00409
• CAZy Family: CE12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
599	MGYG000000060_1|CGC6	64632.87	4.6755

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000060	3236509	Isolate	United Kingdom	Europe

• Gene Location: Start: 421828; End: 423627 Strand: -

Full Sequence      

MKNKNRRRISCLLSAVLLLVMSFGFGTFAGAEESDSSKPVVWIVGDSTVSAFTDNYYYPR
YGWGTQIDKYLDGTFEVKNIALSGRSSTSYTADKEYGELIAGMKKGDFLLVGFGHNDEKA
ESGRYTNPNGDYKTAGSFANSLYENYIKPAQAAGTTVVLCTPIVRRTADGNWSDSQLHVT
AASGEFEGGSYPQAIINLGKDLNVPVVDMTSLTKKLYDSLGAAETVNLHAWTSSKPESVD
NTHTNIWGGTYNAYLVTKTIKELNVAGLAEHIIDAKAPTKSDVLKSNPDYKESEYSNDLK
DSELWANAGIFKGTVFGNVGGNDKIASKFKLESLDNGNINIAVNGAGKIAGTADGIAMYY
YRVPANSNFTITAKATVNSFTSNDQVSFGLMARDDMYIDQNNNNTLGDYVAAGPLKLTKK
GSVWNCFARKSGALTQGGTCTNEIKAGETYNLKIESNTDGYACTFGNEETITGGFDFKLT
SVDSEYVYVGMYVARSADVTFSDVKLVVDGKEITSAGEPENPTPGEPENPTPGEPENPAP
EQPAKPETPAEQPATDPVVSDNNGVETGDSYHMVWYIAAMTLTAGIACVELKRKKTFDK

Enzyme Prediction     

No EC number prediction in MGYG000000060_00409.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE12	41	260	3.3e-52	0.9904761904761905

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01821	Rhamnogalacturan_acetylesterase_like	4.67e-50	39	260	1	198	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
NF033839	PspC_subgroup_2	2.73e-05	518	557	346	389	pneumococcal surface protein PspC, LPXTG-anchored form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A.
NF033930	pneumo_PspA	3.81e-05	500	554	343	400	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
pfam13472	Lipase_GDSL_2	9.51e-05	43	212	1	150	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
NF033913	fibronec_FbpA	1.25e-04	511	565	200	266	LPXTG-anchored fibronectin-binding protein FbpA. FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL50681.1	4.64e-245	1	517	1	523
QAV09174.1	1.96e-219	31	513	1405	1888
ACR72407.1	1.08e-173	41	505	4	472
CBL00444.1	4.88e-121	17	510	810	1331
QSI01052.1	7.37e-96	41	506	50	524

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1DEO_A	6.42e-08	41	260	3	212	RHAMNOGALACTURONANACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.55 A RESOLUTION WITH SO4 IN THE ACTIVE SITE [Aspergillus aculeatus],1DEX_A RHAMNOGALACTURONAN ACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.9 A RESOLUTION [Aspergillus aculeatus],1K7C_A Rhamnogalacturonan acetylesterase with seven N-linked carbohydrate residues distributed at two N-glycosylation sites refined at 1.12 A resolution [Aspergillus aculeatus],1PP4_A The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus],1PP4_B The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus]
3C1U_A	2.82e-07	41	260	3	212	ChainA, Rhamnogalacturonan acetylesterase [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31523	8.96e-20	38	273	4	224	Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) OX=224308 GN=rhgT PE=1 SV=1
O31528	3.91e-10	41	273	5	214	Probable rhamnogalacturonan acetylesterase YesY OS=Bacillus subtilis (strain 168) OX=224308 GN=yesY PE=1 SV=1
P22751	2.36e-08	319	506	56	278	Pectate disaccharide-lyase OS=Dickeya chrysanthemi OX=556 GN=pelX PE=1 SV=1
Q00017	4.22e-07	41	260	20	229	Rhamnogalacturonan acetylesterase OS=Aspergillus aculeatus OX=5053 GN=rha1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002087	0.979467	0.016291	0.001646	0.000280	0.000208

TMHMM  Annotations     

start	end
9	31