CAZyme Information: MGYG000000060_02160

Basic Information

• Species: Lachnospira eligens_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira eligens_A
• CAZyme ID: MGYG000000060_02160
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518	MGYG000000060_6|CGC1	57710.55	5.0347

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000060	3236509	Isolate	United Kingdom	Europe

• Gene Location: Start: 81473; End: 83029 Strand: +

Full Sequence      

MELKLVIKTGRSAVVEFDDGGKYYSKEEYTLLINGEEYGKTEKVVTTIYGLKPDTEYKIT
AVYAGKEYGPVEFKTDYEYVTLNVREFGAYGDGEHDDTNAIQCAIMAAPKDSRVLVPEGV
YKISSIFLKDNLNLELAKGAVLSAFTERNKFPILPGQIETYDEKDYYNLGTWEGNPLDMF
SAIVCGINCSNVTITGEGTIDGCTTHDNWWKNCKIRNTAWRPRLFFINNCSNVTMHGITV
QNSPSWTIHPYFSKHLKFIDVKILNPANSHNTDGLDPESCQDVLVLGTYISVGDDCIAIK
SGKIYMAQKEKTPTEDMTVRQCCMRDGHGAVTVGSEIAAGVKDVHIRDCMFMNTDRGLRV
KTRRGRGKLSVLDDISFENIDMDNVMTPFVVNSFYFCDPDGKTEYVGSRKPLPVDDRTPS
IKSLTFKDINAKNCHVAGAYIFGLPESKVEKLTFENINFSYAKDAKPGVAAMMLGCDEAS
RQGLIVSNVEKLILKNVNIEGCDGEAIVADNVDKIERD

Enzyme Prediction     

No EC number prediction in MGYG000000060_02160.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	104	469	1.3e-78	0.9353846153846154

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	2.96e-91	25	513	19	529	Polygalacturonase [Carbohydrate transport and metabolism].
PLN02188	PLN02188	5.91e-29	81	395	36	320	polygalacturonase/glycoside hydrolase family protein
pfam00295	Glyco_hydro_28	1.11e-27	184	463	48	307	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02218	PLN02218	2.98e-25	81	400	67	359	polygalacturonase ADPG
PLN03010	PLN03010	4.92e-25	83	395	48	320	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR72585.1	0.0	1	518	1	518
ABX43097.1	7.03e-243	1	515	1	515
BCJ96409.1	3.20e-229	1	517	1	516
QOV20147.1	1.06e-227	1	517	1	517
VCV21973.1	3.41e-224	1	513	1	514

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	3.54e-40	82	385	28	347	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	3.08e-37	82	380	45	355	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
2UVE_A	1.43e-28	47	433	116	536	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
1BHE_A	3.79e-25	98	460	26	362	ChainA, POLYGALACTURONASE [Pectobacterium carotovorum]
4MR0_A	4.10e-09	74	243	108	264	Crystalstructure of PfbA, a surface adhesin of Streptococcus pneumoniae [Streptococcus pneumoniae R6],4MR0_B Crystal structure of PfbA, a surface adhesin of Streptococcus pneumoniae [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27644	3.48e-51	229	446	29	247	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
A7PZL3	7.21e-44	86	466	67	431	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P15922	1.28e-28	50	433	114	529	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1
P43212	3.08e-25	82	395	59	346	Polygalacturonase OS=Cryptomeria japonica OX=3369 PE=1 SV=1
Q8RY29	2.26e-24	81	430	67	379	Polygalacturonase ADPG2 OS=Arabidopsis thaliana OX=3702 GN=ADPG2 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000060_02160.