CAZyme Information: MGYG000000060_02424

Basic Information

• Species: Lachnospira eligens_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira eligens_A
• CAZyme ID: MGYG000000060_02424
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000000060_7|CGC2	43216.34	5.3094

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000060	3236509	Isolate	United Kingdom	Europe

• Gene Location: Start: 137581; End: 138720 Strand: -

Full Sequence      

MNNKKPDKKEIENKLNLVIDKLMNLGRPDNDEELEKGGESIGFFKRDFGIKEWDWPQGVG
LYGLLKIMQINGNDEYREFLYKWFKENIAEGLPSKNINTTTPLLTLVELNNYYNDTQFEE
LCIKWAEWLMNCLPRTKERGFQHVTSANGDRQGVRLNENEMWIDTLFMTVLFLNKMGQKY
NRQDWINESIHQVLMHIKYLCDNKTGLFYHGWTFNEMNNFGGIFWCRGNSWFTLGILDYV
DMFKGTLNSGVKEIIIDAYKAQTAALKKLQSKSGLWHTVLTDSSSYEEVSGSAAITAGIL
KGIRMGILDDSYIDVADKAINAILKNIDSDGTVLNVSGGTGMGYDAEHYKNILIAPMAYG
QSLTILALVEALQNDKKSI

Enzyme Prediction     

No EC number prediction in MGYG000000060_02424.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	51	372	2.1e-102	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	7.50e-97	51	374	32	352	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	4.48e-89	52	372	26	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR73371.1	2.68e-287	1	379	16	394
QJU19354.1	1.11e-232	7	372	10	375
ASN96412.1	2.23e-232	7	372	10	375
QRP38799.1	2.23e-232	7	372	10	375
QQQ99851.1	2.13e-230	7	372	10	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	1.49e-81	53	374	65	379	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.69e-77	53	374	66	380	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	3.99e-73	10	370	7	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
1NC5_A	4.03e-17	53	370	39	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.68e-16	53	370	29	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	5.72e-53	44	377	23	341	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	2.21e-16	53	370	39	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000060_02424.