CAZyme Information: MGYG000000060_02735

Basic Information

• Species: Lachnospira eligens_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira eligens_A
• CAZyme ID: MGYG000000060_02735
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335		38550.75	4.864

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000060	3236509	Isolate	United Kingdom	Europe

• Gene Location: Start: 109636; End: 110643 Strand: -

Full Sequence      

MKSKKTNPFVITTLIFFMTTVMFGLLTTGVIIKYRKSTVATNTDKLSNDEIEKLKSEEKE
DLLSDMKLRFTNGEGSLSILKSYFPDNIVYVNNKNQYVFAQILPELAKNNYKDENFKQDD
KGIITYNEDGKVTTHMGVDASKFQGNIDFKKLKEQGVEFAMLRCGFRSYGNGILNTDSSF
DTFAKDAIKNNIKIGAYFFSSAITKQEAIEEADYVLDIIKPYRITYPVVIDFEEISGDSY
RQENLTTEELTDIIIAFCDKIEKAGYKPMIYSNLKGFVGRLDLTRLEKYEKWFAYYSDTP
YFPYEFSIWQYTESAKLDGVSGNTIDLNISFKDYN

Enzyme Prediction     

No EC number prediction in MGYG000000060_02735.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	138	320	8.7e-42	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	3.59e-79	137	331	3	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	5.76e-33	137	329	2	185	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	1.20e-29	138	320	1	180	Glycosyl hydrolases family 25.
cd06525	GH25_Lyc-like	4.66e-24	137	328	2	182	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06524	GH25_YegX-like	1.19e-22	137	329	2	191	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR72973.1	6.96e-239	1	335	1	335
QNM03294.1	1.04e-73	36	334	83	380
AOZ96288.1	2.46e-70	49	334	77	362
ADL34306.1	1.38e-69	41	334	70	362
BBF45127.1	8.65e-68	100	334	46	280

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAG_A	1.59e-11	137	331	18	207	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
4KRU_A	4.25e-09	137	328	22	205	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	9.59e-09	137	328	22	205	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26836	8.47e-10	137	335	11	211	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
P34020	2.62e-08	137	323	3	174	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.972186	0.023449	0.000331	0.000124	0.000084	0.003852

TMHMM  Annotations     

start	end
10	32