CAZyme Information: MGYG000000061_01339

Basic Information

• Species: Collinsella aerofaciens_E
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella aerofaciens_E
• CAZyme ID: MGYG000000061_01339
• CAZy Family: GH140
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
439	MGYG000000061_23|CGC1	49445.66	4.6963

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000061	2183788	Isolate	United Kingdom	Europe

• Gene Location: Start: 5564; End: 6883 Strand: -

Full Sequence      

MSLGKLTVNGRQDGFLCDDKPFFWFADTCWSAFTSIAEDDWDYYLTRRAEQGMNVLQVNT
LPQWDRCLPDLGIWPYASEDGVHFDWSAPNQEYWDRARRMCQAAVEHGIRPALVLMWCNY
VPGTWGSMIAERTGAEVMPRSEVRRHVARVVENLGEFDPVYVVTGDTDFAGDEAIAYYED
ALDEVVKRAPEALRTMHINRANRTIPAQYLDRLDFYMFQPGHNYEGQPEAWRLPQDFIAN
YPKKPMVNSEPCYEQMGASRNVYWRFTAQDCRASVWSSILAGASAGITYGAHGVWNWQTS
QSRGSVLGEGFDMPFRWQECLQFAGVWDFGLIEHVLRGLGATAGDDAAAVVPAQELLDDA
REAIRVARVGERVVVYLPRTTAVKLKLEGGVTAWNAVAFDLETKRVANLPVASVDGDGEI
RVAQHPFEHDALLVVSPAK

Enzyme Prediction     

No EC number prediction in MGYG000000061_01339.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	17	388	2.9e-87	0.8616504854368932

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13204	DUF4038	1.22e-79	9	339	1	320	Protein of unknown function (DUF4038). A family of putative cellulases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP54527.1	1.59e-303	1	439	1	437
AZH70520.1	3.15e-294	1	439	1	437
AEB07692.1	5.23e-201	1	437	1	456
QWT17210.1	9.32e-201	1	435	1	435
QRT29801.1	3.40e-151	3	439	1	426

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	4.49e-18	2	294	14	309	Glycosidehydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	1.12e-15	2	294	14	309	Crystalstructure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4QFU_A	1.53e-12	4	290	29	318	ChainA, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_B Chain B, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_C Chain C, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_D Chain D, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_E Chain E, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_F Chain F, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_G Chain G, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_H Chain H, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_I Chain I, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_J Chain J, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_K Chain K, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_L Chain L, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000061_01339.