CAZyme Information: MGYG000000062_00174

Basic Information

• Species: Intestinibacter bartlettii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Intestinibacter; Intestinibacter bartlettii
• CAZyme ID: MGYG000000062_00174
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
179	MGYG000000062_1|CGC1	20899.12	7.8631

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000062	3140386	Isolate	United Kingdom	Europe

• Gene Location: Start: 200965; End: 201504 Strand: +

Full Sequence      

MKKKLILILLILIVLGVALFIGKNDIYKYLYPKKYSNYVEFYSKEYNLDENLVYSIIKAE
SKFKEDAVSRKGAKGLMQIGDGTRDWAAEELKLEKVDIFKPQDNIRIGCWYLNRLYREFG
DLDLVIAAYNGGSGNVKKWLADEEFSSDGENLETIPFKETASYVEKVKYNYEMYKKIYN

Enzyme Prediction     

No EC number prediction in MGYG000000062_00174.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	50	175	1.8e-30	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.94e-69	32	173	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	7.82e-48	30	177	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.32e-37	50	172	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	7.21e-35	21	179	125	288	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.15e-28	41	141	3	104	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPK99408.1	5.37e-82	1	178	1	178
AVD40846.1	5.37e-82	1	178	1	178
QQY50391.1	5.37e-82	1	178	1	178
QQY75444.1	5.37e-82	1	178	1	178
QQY70836.1	5.37e-82	1	178	1	178

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	9.27e-19	27	174	408	555	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	9.29e-19	27	174	412	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	9.32e-19	27	174	418	565	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	9.34e-19	27	174	422	569	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	9.37e-19	27	174	428	575	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31976	4.48e-14	31	171	1418	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	4.48e-14	31	171	1418	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P44888	5.18e-14	32	167	425	565	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
P39434	7.18e-14	31	167	476	618	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC4	3.33e-13	31	167	476	618	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.838583	0.120577	0.038625	0.000376	0.000235	0.001612

TMHMM  Annotations     

start	end
5	22