CAZyme Information: MGYG000000062_00484

Basic Information

• Species: Intestinibacter bartlettii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Intestinibacter; Intestinibacter bartlettii
• CAZyme ID: MGYG000000062_00484
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
414		46393.04	4.6247

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000062	3140386	Isolate	United Kingdom	Europe

• Gene Location: Start: 528251; End: 529495 Strand: -

Full Sequence      

MKNCDKKYSCLDWYLCFINQENRQNMPEYIDKSNDSKYVYPKQKSINKPNSKRNEIQKYK
TVNPNCPNLNPIVFQYVLGNPQNLDPTYLDAAIYAFVEIDDDGNLNVPSPRYLNQMLALK
DVKPSLKIIAAIGGWGADGFSDAALTPTSRYNFARNVNQLVNDYGLDGIDIDWEYPGSGA
SGIKARPEDKENFTLLLTALRDVLGEDKWISVAGTGDTGYINRSAEIDKIAPIITYFNLM
SYDFTAGETGDRGKKHQANLFDSNLSLSGYSVDSMVTNLINAGMPSRKINLGVPFYGRLG
ATNTKSYDELRANYINKNGYTYNFDNQALVPYLVKDGDFAMSFDNDLSIFLKAKYVLQNC
LGGIFSWTSTYDQANILGRAMYLAINDTNNFEDELADIYGSVPDLPEGNVQKNI

Enzyme Prediction     

No EC number prediction in MGYG000000062_00484.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	83	376	1.6e-59	0.8614864864864865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	1.51e-91	81	372	18	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	4.73e-67	80	372	17	334	Glyco_18 domain.
pfam00704	Glyco_hydro_18	1.30e-66	79	372	13	307	Glycosyl hydrolases family 18.
cd02872	GH18_chitolectin_chitotriosidase	1.78e-62	75	368	10	337	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
COG3325	ChiA	2.72e-55	81	381	57	432	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJA08894.1	2.96e-194	3	403	195	582
QUP85215.1	4.10e-186	63	400	370	707
AXU86322.1	4.10e-186	63	400	370	707
CDT21063.1	4.10e-186	63	400	370	707
AXU45984.1	4.10e-186	63	400	370	707

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TSB_AAA	1.27e-192	63	400	28	365	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	2.53e-192	63	400	47	384	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
5GZU_A	4.35e-52	98	382	82	392	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZU_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_A Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
5GZT_B	7.85e-52	98	382	333	643	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
6INX_A	5.05e-48	119	388	56	345	Structuralinsights into a novel glycoside hydrolase family 18 N-acetylglucosaminidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	3.23e-41	113	377	142	443	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
Q9D7Q1	4.93e-29	81	372	43	361	Chitotriosidase-1 OS=Mus musculus OX=10090 GN=Chit1 PE=1 SV=2
Q13231	1.76e-28	81	372	43	363	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
H2A0L4	2.46e-28	81	372	43	358	Putative chitinase 1 OS=Margaritifera margaritifera OX=102329 PE=1 SV=1
Q5AM60	5.02e-26	81	372	40	355	Chitinase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHT4 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000062_00484.