CAZyme Information: MGYG000000063_02102

Basic Information

• Species: Emergencia sp900066695
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Anaerovoracaceae; Emergencia; Emergencia sp900066695
• CAZyme ID: MGYG000000063_02102
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
561	MGYG000000063_3|CGC1	63338.47	5.7268

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000063	4293331	Isolate	United Kingdom	Europe

• Gene Location: Start: 521972; End: 523657 Strand: -

Full Sequence      

MAKKFFSVFLICLLVCVMVSEHSIEGLMVASEKGGKDYIKWVDFDITYEALEDAMNVDIE
TYEQDLHISWVDILAFLACKYGGDFSMYSHKDIDWFAAKLNEGSSVDDITSNMKSYPYYY
KAYCAVIGNFLGLDKDGNYGLTAYSPVAEGYWYTDSDDFGNGRSYGFARKHLGHDMFCSV
GTPVAAVEGGKVEALGWNQYGGWRIGIRSHDGFRYYYYAHLRKDSPYIKDLKEGDTVKAG
QIIGYSGQSGYSVKENVNNINVPHLHFGMQLVFDESQKECNSEIWIDTYALIRLLSKHRA
SPEVKETAKTAAATAEVPILMYHGLTKKQSQVNDYFIPASTFESDMKYLKEHGYTAITMT
ELIDYVYDKTGKVALPEKPVIITFDDGYCNNYNYAAPVLEKYGMKAVISVIGHACEEASV
AEHRAEDYCNVTWDQIQEMSNSGHWEIQNHTWDFHEAKGGRKGASKKRGESEEVYEKTLK
EDLSKLQKKLKETTGVSPNTFTWPFGAYTEDSRDLLKTLGFKATLSCNGGINTIKKGDTE
GLYLLKRKLRTPKDSIAELLQ

Enzyme Prediction     

No EC number prediction in MGYG000000063_02102.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	374	524	1.1e-29	0.9230769230769231

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10918	CE4_NodB_like_5s_6s	3.22e-40	379	547	1	151	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
TIGR03938	deacetyl_PgaB	2.55e-39	319	534	5	236	poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB. Two well-characterized systems produce polysaccharide based on N-acetyl-D-glucosamine in straight chains with beta-1,6 linkages. These are encoded by the icaADBC operon in Staphylococcus species, where the system is designated polysaccharide intercellular adhesin (PIA), and the pgaABCD operon in Gram-negative bacteria such as E. coli. Both systems include a putative polysaccharide deacetylase. The PgaB protein, described here, contains an additional domain lacking from its Gram-positive counterpart IcaB (TIGR03933). Deacetylation by this protein appears necessary to allow export through the porin PgaA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
cd10969	CE4_Ecf1_like_5s	1.12e-37	341	560	3	211	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10964	CE4_PgaB_5s	5.95e-31	375	539	1	183	N-terminal putative catalytic polysaccharide deacetylase domain of bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, and similar proteins. This family is represented by an outer membrane lipoprotein, poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase (PgaB, EC 3.5.1.-), encoded by Escherichia coli pgaB gene from the pgaABCD (formerly ycdSRQP) operon, which affects biofilm development by promoting abiotic surface binding and intercellular adhesion. PgaB catalyzes the N-deacetylation of poly-beta-1,6-N-acetyl-D-glucosamine (PGA), a biofilm adhesin polysaccharide that stabilizes biofilms of E. coli and other bacteria. PgaB contains an N-terminal NodB homology domain with a 5-stranded beta/alpha barrel, and a C-terminal carbohydrate binding domain required for PGA N-deacetylation, which may be involved in binding to unmodified poly-beta-1,6-GlcNAc and assisting catalysis by the deacetylase domain. This family also includes several orthologs of PgaB, such as the hemin storage system HmsF protein, encoded by Yersinia pestis hmsF gene from the hmsHFRS operon, which is essential for Y. pestis biofilm formation. Like PgaB, HmsF is an outer membrane protein with an N-terminal NodB homology domain, which is likely involved in the modification of the exopolysaccharide (EPS) component of the biofilm. HmsF also has a conserved but uncharacterized C-terminal domain that is present in other HmsF-like proteins in Gram-negative bacteria. This alignment model corresponds to the N-terminal NodB homology domain.
cd10966	CE4_yadE_5s	2.69e-30	376	559	1	164	Putative catalytic polysaccharide deacetylase domain of uncharacterized protein yadE and similar proteins. This family contains an uncharacterized protein yadE from Escherichia coli and its bacterial homologs. Although its molecular function remains unknown, yadE shows high sequence similarity with the catalytic NodB homology domain of outer membrane lipoprotein PgaB and the surface-attached protein intercellular adhesion protein IcaB. Both PgaB and IcaB are essential in bacterial biofilm formation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASF40455.1	4.76e-44	316	547	209	436
CCG46444.1	4.76e-44	316	547	209	436
AFS79569.1	9.83e-43	310	547	24	255
ARI76505.1	1.67e-42	305	537	215	447
AFS77609.1	1.90e-36	316	535	21	243

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4U10_A	7.10e-22	319	520	6	225	Probingthe structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans],4U10_B Probing the structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans]
4QP5_A	1.09e-18	171	267	33	117	Catalyticdomain of the antimicrobial peptidase lysostaphin from Staphylococcus simulans crystallized in the presence of phosphate [Staphylococcus simulans bv. staphylolyticus],4QP5_B Catalytic domain of the antimicrobial peptidase lysostaphin from Staphylococcus simulans crystallized in the presence of phosphate [Staphylococcus simulans bv. staphylolyticus],4QPB_A Catalytic domain of the antimicrobial peptidase lysostaphin from Staphylococcus simulans crystallized in the absence of phosphate [Staphylococcus simulans],4QPB_B Catalytic domain of the antimicrobial peptidase lysostaphin from Staphylococcus simulans crystallized in the absence of phosphate [Staphylococcus simulans]
5BU6_A	2.41e-18	333	533	34	250	Structureof BpsB deaceylase domain from Bordetella bronchiseptica [Bordetella bronchiseptica RB50],5BU6_B Structure of BpsB deaceylase domain from Bordetella bronchiseptica [Bordetella bronchiseptica RB50]
3NYY_A	2.87e-18	153	299	109	245	Crystalstructure of a putative glycyl-glycine endopeptidase lytM (RUMGNA_02482) from Ruminococcus gnavus ATCC 29149 at 1.60 A resolution [[Ruminococcus] gnavus ATCC 29149]
5NMY_A	1.15e-17	171	267	31	115	NMRsolution structure of lysostaphin [Staphylococcus simulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32130	2.06e-20	100	269	132	297	L-Ala--D-Glu endopeptidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lytH PE=2 SV=2
P94361	2.23e-18	315	552	63	264	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1
Q8NUI6	1.33e-16	331	522	71	247	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaB PE=3 SV=1
Q6GDD6	1.33e-16	331	522	71	247	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaB PE=3 SV=1
Q7A349	1.33e-16	331	522	71	247	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000241	0.999176	0.000161	0.000140	0.000130	0.000127

TMHMM  Annotations     

start	end
5	24