CAZyme Information: MGYG000000063_03446

Basic Information

• Species: Emergencia sp900066695
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Anaerovoracaceae; Emergencia; Emergencia sp900066695
• CAZyme ID: MGYG000000063_03446
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
205		23418.87	5.7727

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000063	4293331	Isolate	United Kingdom	Europe

• Gene Location: Start: 56216; End: 56833 Strand: -

Full Sequence      

MRRLFKGFAITVLVTVLIGAIVSAPTVYKGYQLYRSVVKETAIAEKVAEIKRSVNYVELD
DISDYFKDEIIKSEDKRFWFHFGIDPLAIIRAIKNDILAGSFVEGGSTITQQLAKNMYFD
FDKNFERKVAEVFVAFHLEKDYSKDEILEMYLNCIYFGENCYGIKEAANHYYGAVPETIS
KSQADSLVITIKCPNLYNPNERNAA

Enzyme Prediction     

No EC number prediction in MGYG000000063_03446.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	48	202	5.8e-54	0.8757062146892656

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	2.56e-66	56	205	15	164	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	6.13e-58	2	200	13	223	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	8.81e-57	56	199	4	147	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	3.10e-49	43	199	59	212	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK13481	PRK13481	4.75e-40	50	201	41	198	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABX41988.1	2.75e-75	8	200	9	201
SET84136.1	2.85e-75	14	204	16	206
BBF43413.1	3.63e-68	1	201	1	201
QQY26839.1	2.70e-54	29	201	26	198
QQV06180.1	2.70e-54	29	201	26	198

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	9.09e-37	56	199	22	165	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	3.61e-36	56	199	22	165	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	7.32e-34	45	200	48	209	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	8.07e-34	45	200	12	173	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	8.28e-34	45	200	13	174	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38050	4.60e-36	57	199	70	212	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
A5IU40	3.48e-33	45	200	71	232	Monofunctional glycosyltransferase OS=Staphylococcus aureus (strain JH9) OX=359786 GN=mgt PE=3 SV=1
A6U2X8	3.48e-33	45	200	71	232	Monofunctional glycosyltransferase OS=Staphylococcus aureus (strain JH1) OX=359787 GN=mgt PE=3 SV=1
O66874	4.56e-33	56	199	65	208	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
Q5HEQ0	6.89e-33	45	200	71	232	Monofunctional glycosyltransferase OS=Staphylococcus aureus (strain COL) OX=93062 GN=mgt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.810504	0.095133	0.036648	0.000744	0.000430	0.056549

TMHMM  Annotations     

start	end
7	28