CAZyme Information: MGYG000000064_00719

Basic Information

• Species: Clostridium baratii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium baratii
• CAZyme ID: MGYG000000064_00719
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
298		34573.99	7.2326

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000064	3139911	Isolate	United Kingdom	Europe

• Gene Location: Start: 685050; End: 685946 Strand: -

Full Sequence      

MLKGIDVSEHQGVIDWNKVKDHVDFVMLRAGYGKNNIDKQFERNIKECNRLGIPVGIYWF
SYALNEDMARQEAKYALAAVKDYRLEYPISFDLEYDTLDYAKKNGINIDKRLATNMVKAF
CSEIEAAKYYAMNYTNQDFINNHFYFNEIERYCPWYAWYNKELDRSNVGMWQYSDKGTVP
GIQGSSVDLDYARVDFAKDIKNRHLNNIDNSNPAPKPSYKLIPQNGTCTVLVDELMIREE
PSTSSKAVGSYNKGESVIYDYYVDNEGYRWISWVGASGKRRYMAVRVLATNKKYGNCV

Enzyme Prediction     

No EC number prediction in MGYG000000064_00719.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	5	182	7.2e-47	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	1.68e-78	3	192	2	190	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	2.04e-32	3	192	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06525	GH25_Lyc-like	1.35e-23	3	191	1	183	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06413	GH25_muramidase_1	1.09e-21	3	189	4	186	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
pfam01183	Glyco_hydro_25	1.04e-20	5	182	1	180	Glycosyl hydrolases family 25.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQM59299.1	2.68e-222	1	298	1	298
AIY82997.1	5.28e-167	1	278	1	275
AXH51956.1	3.03e-101	1	278	1	258
ASY52765.1	3.98e-99	1	278	1	258
AWS24349.1	3.98e-99	1	278	1	258

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WW5_A	4.44e-21	3	184	270	460	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	1.11e-20	3	184	270	460	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]
5D74_A	3.42e-12	224	296	194	267	Thecrystal structure of Ly7917 [Streptococcus phage phi7917],5D74_B The crystal structure of Ly7917 [Streptococcus phage phi7917],5D76_A The crystal structure of Ly7917 with the hydrolyzing product of MDP [Streptococcus phage phi7917],5D76_B The crystal structure of Ly7917 with the hydrolyzing product of MDP [Streptococcus phage phi7917]
5UDN_A	3.99e-10	214	285	166	237	Phage-associatedcell wall hydrolase PlyPy from Streptococcus pyogenes, space group P3121 [Streptococcus pyogenes MGAS5005],5UDN_B Phage-associated cell wall hydrolase PlyPy from Streptococcus pyogenes, space group P3121 [Streptococcus pyogenes MGAS5005]
4JZ5_A	1.68e-09	1	201	22	221	High-resolutionstructure of catalytic domain of endolysin ply40 from bacteriophage P40 of Listeria monocytogenes [Listeria phage P40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26836	1.25e-11	2	270	9	255	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
Q8X7H0	2.86e-07	2	185	67	248	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P34020	3.67e-07	2	190	1	178	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1
P76421	3.84e-07	2	184	67	247	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8FFY2	5.17e-07	2	184	67	247	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000064_00719.