CAZyme Information: MGYG000000064_01409

Basic Information

• Species: Clostridium baratii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium baratii
• CAZyme ID: MGYG000000064_01409
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
235	MGYG000000064_1|CGC16	26693.81	9.303

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000064	3139911	Isolate	United Kingdom	Europe

• Gene Location: Start: 1363207; End: 1363914 Strand: -

Full Sequence      

MKSIILHEGKLLWIFTALALLLIVSFGFFSYKLETNDKLLSYKIDSIRNDRNYVKLENID
KKFLDSMVAIEDHRFYSHGALDYISIARATINNVKARKVVEGGSTITQQLAKNLCLSNER
SFKRKFKEVLLAFELEKKYSKEEILELYVNVINFGDGNIGIGQAAKGYFGKSAKYLTYGE
ATMLAGLPQAPSVYALSNNNELCKKRQSQVINALEKYNGIEEENFAVTPKFECNK

Enzyme Prediction     

No EC number prediction in MGYG000000064_01409.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	48	214	6.1e-63	0.9378531073446328

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	3.11e-78	48	215	10	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	5.48e-70	50	223	1	174	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	4.92e-69	12	223	23	249	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	6.61e-63	1	212	1	228	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	1.94e-46	51	231	58	239	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQM60850.1	4.76e-155	1	235	1	235
AIY83278.1	1.59e-153	1	235	1	235
AWZ49221.1	1.56e-82	7	217	2	212
AZV41456.1	9.80e-69	27	217	27	217
QOR67159.1	5.38e-66	14	217	14	217

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	4.68e-39	51	211	20	180	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	1.86e-38	51	211	20	180	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	7.91e-33	51	225	39	213	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
7U4H_A	3.86e-32	33	196	24	183	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
5U2G_A	6.97e-32	54	227	43	218	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O87626	1.73e-39	51	212	68	229	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
P0A0Z6	6.38e-37	51	212	68	229	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1
Q5FAC7	6.38e-37	51	212	68	229	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=mrcA PE=3 SV=3
P0A0Z5	6.38e-37	51	212	68	229	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mrcA PE=3 SV=1
O05131	6.38e-37	51	212	68	229	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae OX=485 GN=mrcA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.978715	0.001089	0.001951	0.000006	0.000005	0.018247

TMHMM  Annotations     

start	end
12	31