CAZyme Information: MGYG000000064_01532

Basic Information

• Species: Clostridium baratii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium baratii
• CAZyme ID: MGYG000000064_01532
• CAZy Family: GH2
• CAZyme Description: Evolved beta-galactosidase subunit alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1005	MGYG000000064_1|CGC18	117565.48	5.2151

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000064	3139911	Isolate	United Kingdom	Europe

• Gene Location: Start: 1487466; End: 1490483 Strand: -

Full Sequence      

MLLNSYHENISFLHVNMMPRRSYYIPFKSVDESLKKISRDSQMSFKSLNGTWKFKYFDSF
ENVNINNLLDNKKENFDLIKVPSVWQMQGYDNNQYTNVKYPIGFNPPFVPTNNPCGFYIR
DFEIDSFSRDKDYHLNFEGVDSCFYIWVNSKFIGYSQISHSISEFDITKEVLEGKNTIAV
LVLKWCDGTYFEDQDKFRMSGIFRDVYILERDKSRIVDYKIDTDINLEEKVGFLNLKVID
KINNPSISYSLLNPNDEIIQSGFINNDYITLKIEEVELWNPEVPKLYTLLIKTDNEVIRE
KVGMRVVSIEDGVLKLNGVNVKLRGVNHHDSHPLNGYVITDEDLLLDLRLMKEYNFNSIR
TAHYPKSPKFYEMCDKYGFLVINESDIEAHGVVELYGHGYLENYNMIANDPIYEKVIEDR
IEASIIPYKNRPCIFMWSVGNESGFGCNFEKGLIRARELDSTRLLHYEGAFYADKNRLND
FSNIDVISRMYPSIDEINEYFNSGIDKPFILCEYAHAMGNGPGGLKEYDKLIQENKEFAG
AYVWEWCDHAIDMGKSKDGKIMYGYGGDFGEIFHDGNFCVDGLVYPNRVPHTGVLEYQNI
NRPVRLVEVDEINKKVKLKNMMDFSDVDDFFKIKYKLFSDGDIISEKELVIDSLKAKEEK
WYSLDLPEIPNKIVTILFEYIIKENFLLYKEGLKLGHDQIVWSNNVKNLKSFESITEVKK
CEEGFIVNESTKEINIINGEFNYIYDKNTALFKLIENKKCRFIKECMKFKVWRAPTDNDR
KIKLEWIEAGFNNLESRVYKTTIENKQNYIKITSYMSLIPIYREKVLDIVIKWTILPNGL
IKSEINAVKNVNSPFLPRFGVEIKLDKSYENLSYFGLGPYENYQDKHSASYLSRFNTTVS
KMHEDYICPQENGSRSLCKEVKIYNENSNIYITSHNDFSFNASHFSTEELTNKRHNFELV
QDDATYIIVDYKQSGIGSNSCGPELDYQYRLNEKDINFNFYIKFE

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	36	891	3.1e-188	0.9707446808510638

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	0.0	8	991	18	1022	beta-galactosidase.
PRK10340	ebgA	0.0	8	1003	5	998	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	1.02e-126	43	597	10	549	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	2.47e-82	307	604	1	300	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
smart01038	Bgal_small_N	4.49e-76	738	1002	2	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB83422.1	0.0	1	1005	1	1005
AXH51823.1	0.0	2	1004	3	1004
AQW26069.1	0.0	2	1004	3	1004
AMN34998.1	0.0	2	1004	3	1004
QQA11641.1	0.0	2	1004	3	1004

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	4.41e-165	45	1000	38	977	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	4.52e-165	45	1000	39	978	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3OB8_A	9.27e-154	13	1005	22	1032	Structureof the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_B Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_C Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_D Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OBA_A Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_B Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_C Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_D Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis]
6CVM_A	3.98e-138	15	992	20	1009	Atomicresolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6CVM_B Atomic resolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6CVM_C Atomic resolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6CVM_D Atomic resolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6X1Q_A 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12],6X1Q_B 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12],6X1Q_C 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12],6X1Q_D 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12]
3MUY_1	1.18e-136	15	992	21	1010	Chain1, Beta-D-galactosidase [Escherichia coli K-12],3MUY_2 Chain 2, Beta-D-galactosidase [Escherichia coli K-12],3MUY_3 Chain 3, Beta-D-galactosidase [Escherichia coli K-12],3MUY_4 Chain 4, Beta-D-galactosidase [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O33815	1.75e-302	1	1004	1	993	Beta-galactosidase OS=Staphylococcus xylosus OX=1288 GN=lacZ PE=3 SV=1
P70753	3.15e-267	1	1005	1	1000	Beta-galactosidase OS=Actinobacillus pleuropneumoniae OX=715 GN=lacZ PE=3 SV=1
Q56307	2.48e-164	45	1000	39	978	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
P06864	2.19e-155	8	1000	5	995	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
P00723	4.26e-153	13	1005	15	1025	Beta-galactosidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=LAC4 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000064_01532.