CAZyme Information: MGYG000000064_02651

Basic Information

• Species: Clostridium baratii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium baratii
• CAZyme ID: MGYG000000064_02651
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
156		18273.49	10.0514

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000064	3139911	Isolate	United Kingdom	Europe

• Gene Location: Start: 39091; End: 39561 Strand: +

Full Sequence      

MKKVIFISSTGGHLSELMQLKRIFNNYDYHIITEKTDTTIKLKNEYGKRIDYLVYGARNY
LFSYIFKFSYNVIKSLFLYLKIRPDVIVTTGAHTAVPICYIAKFFKKKIIFVESFARVNS
KSMSGKMINKIADVFLVQHKELLDVYENSTYKGDLY

Enzyme Prediction     

No EC number prediction in MGYG000000064_02651.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08660	Alg14	1.12e-31	5	153	3	169	Oligosaccharide biosynthesis protein Alg14 like. Alg14 is involved dolichol-linked oligosaccharide biosynthesis and anchors the catalytic subunit Alg13 to the ER membrane.
COG0707	MurG	5.55e-15	1	143	1	148	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
cd03785	GT28_MurG	7.27e-08	4	114	3	120	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK00726	murG	0.002	1	114	1	122	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03808	GT4_CapM-like	0.005	3	145	1	153	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQM61264.1	4.85e-107	1	156	1	156
AIY83793.1	1.80e-105	1	156	4	159
QHS23515.1	3.52e-61	2	156	4	156
QXE01113.1	1.43e-60	2	156	4	156
ANB57490.1	3.92e-59	2	156	9	161

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9D081	7.21e-13	3	153	38	214	UDP-N-acetylglucosamine transferase subunit ALG14 homolog OS=Mus musculus OX=10090 GN=Alg14 PE=1 SV=1
Q6BMD0	8.82e-13	4	155	58	231	UDP-N-acetylglucosamine transferase subunit ALG14 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=ALG14 PE=3 SV=2
Q5A5N6	1.44e-11	10	155	56	218	UDP-N-acetylglucosamine transferase subunit ALG14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALG14 PE=3 SV=1
O14199	3.43e-11	84	153	133	207	UDP-N-acetylglucosamine transferase subunit alg14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg14 PE=3 SV=1
Q96F25	7.13e-11	4	153	39	213	UDP-N-acetylglucosamine transferase subunit ALG14 homolog OS=Homo sapiens OX=9606 GN=ALG14 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000064_02651.