CAZyme Information: MGYG000000064_02700

Basic Information

• Species: Clostridium baratii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium baratii
• CAZyme ID: MGYG000000064_02700
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
414	MGYG000000064_5|CGC2	46296.35	5.5548

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000064	3139911	Isolate	United Kingdom	Europe

• Gene Location: Start: 96907; End: 98151 Strand: +

Full Sequence      

MAEKGNLIIQCFNGDAFIPVDGTKATVVQTESPNPQPMEFDLVTDSSGLTQPIQLDAPDF
QYSQTPQSEVRPYSLCDITINRDGFDPLTIKGCQIFPRETAYQRCNLVETSNTRSSRAEI
IQIPDNRLFGNFPNKIPEEVDKLLPPPSSGVVLPKPVIPEFIVVHEGGPNSPGPNRTVPF
KEYIKNVASSEIYSTWSRSTITANAFCIISFTLNRIYTEWYRSKGKNFDITNSTAYDHAF
SFGRNIYENISNIVDEIFSTYVRRIGRKQPLLTQYCDGKNVTCPEWLSQWGSKALGDQGV
APFNILTRYYGTDIELATAEQVKGSPKSYPGFALTIGSRGEPVRSIQEFLNRIADNYPLI
PKVAVDGIFGNSSSQQVKVFQSIFKLPQSGIVDFATWYKISEVYVGVTRIAELR

Enzyme Prediction     

No EC number prediction in MGYG000000064_02700.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01471	PG_binding_1	8.37e-11	339	400	1	57	Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.
COG3409	PGRP	1.22e-06	334	400	39	102	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
COG3409	PGRP	0.001	316	400	103	183	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBJ74211.1	1.09e-201	1	414	1	413
AYE34395.1	3.13e-201	1	414	1	413
QAS59800.1	3.13e-201	1	414	1	413
APF21924.1	3.25e-200	1	414	1	414
QGH20837.1	9.30e-200	1	414	1	414

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000064_02700.