CAZyme Information: MGYG000000064_02909

Basic Information

• Species: Clostridium baratii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium baratii
• CAZyme ID: MGYG000000064_02909
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
475	MGYG000000064_7|CGC1	54907.27	5.2952

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000064	3139911	Isolate	United Kingdom	Europe

• Gene Location: Start: 31745; End: 33172 Strand: +

Full Sequence      

MNSNLNRFPDNFLWGGATAANQCEGAWNVDGKGVSTADVATAGAFGIKREYTDGVEEGKN
YPSHEAIDFYHRYKEDIKMFAEMGFKCFRLSIAWTRIFPNGDDKEPNEKGLEYYDNVFDE
CLKYGIEPVVTISHYEMPYALVEKYGAWRDRRLVDFYVNYCNVIFNRYKDKVKYWMTFNE
INVITMHPFIPAGLRFNEGENREQIIYQAAHHQLIASAKVVKLGHEINPDFKIGCMILYP
LAYAESCNPEDVLLQNEFMNKHYFFSDVQAKGVYPNFMKTYFKRENIEVKFEDGDEETLK
AGKVDFIGFSYYMTLVVSSKNEGKTLTGGNMAKGIKNPYLKASEWGWQIDPVGFRISLNN
LYNRYEIPLFCVENGLGAVDTIEEDGSINDDYRIDYLRQHIIEMKKAITIDGVEMIGYTP
WGCIDLISASTGEMKKRYGFIYVDKDNEGNGTLERKRKKSFYWYKKVIESNGEIL

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	6	472	6.6e-152	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	5	475	1	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	6	475	2	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	8	475	6	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	5	474	1	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	8	473	6	475	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIY83936.1	0.0	1	475	1	475
BCJ93938.1	7.05e-268	7	475	4	473
QAT41214.1	2.63e-251	8	472	5	469
AJQ29705.1	3.50e-247	7	472	5	470
CCP27273.1	4.98e-246	5	473	1	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	1.31e-223	1	475	1	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	9.48e-217	5	473	4	478	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	2.71e-216	5	473	4	478	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	7.52e-209	7	473	6	478	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
2XHY_A	1.03e-208	9	475	9	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	1.12e-219	1	475	1	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P42973	2.09e-210	5	475	1	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46829	5.64e-208	9	475	9	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
Q46130	6.80e-198	8	475	7	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P24240	4.47e-189	8	475	4	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000064_02909.