CAZyme Information: MGYG000000065_00410

Basic Information

• Species: Anaerostipes sp900066705
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Anaerostipes; Anaerostipes sp900066705
• CAZyme ID: MGYG000000065_00410
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
744	MGYG000000065_3|CGC1	86514.98	6.9665

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000065	3036063	Isolate	United Kingdom	Europe

• Gene Location: Start: 67476; End: 69710 Strand: +

Full Sequence      

MNETINREDLYLFQTGKARQAYLTFGCHYQKKTKTHRFTVWAPNAKSVSVVGDFNFWNPL
AHPMKGDKDGIYTIEIEGLKKGDLYKYYVEGYDGICRYKSDPFAFYAECRPDTASKVWDF
DDFKWSDKRFINQRKKRQAIDQPMSIYELHLGTWRMPQEEEREFYNYREIADMLIPYLQK
MGYTHVELMPITEYPYDLSWGYQVTGYYGVTSRYGTPEDFNYMINELHKAGISVILDWVP
AHFPRDEHGLAMFDGTHIYDHEDPRKGSQPDWGTLLFNYGKPEVQSFLISSAMFFADIYH
VDGIRIDAVSAMLYLDFGKQEGEYVPNEDGTNINYEAVDFLHNLNEALRTTYEGFLTIAE
ESTAYPKVTSDIDDPDGLGFVYKWNMGYMHDSLYYMELDPLYRKDNHGAIIFSMDYAYSE
NYILPYSHDEVVHGKGSMINKMYGAYDEKFASLRTLYGFTIAHPGKKLLFMGGEFAQFVE
WRDKEQLDWFLIDQYEMHDSFHEYVAKLNEIYKAHPAFYELDQDPAGFEWCLQRDADHSV
VAFIRKSKRGRGRKQEQILCVCNFTPMEWDKYQIPLPKKSKLTKILDSSELNFGGDGDVS
ETKVSTKRVKVPSEGKATYQQCAQISLKPLSVVYYKIEEVEKKPRKTAAKKTEAAKKVTK
EVVEETKAEETKTVKSTTKVVAKTKKAEPIKKAVQEKKPAPKSETSKKEDTKETTETVTK
EKEQPKKKARKTRRTNKNKNQGVK

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	176	477	1.8e-142	0.9966777408637874
CBM48	25	105	9.1e-18	0.868421052631579

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	6	643	8	633	1,4-alpha-glucan branching protein GlgB.
PRK14705	PRK14705	0.0	4	636	602	1221	glycogen branching enzyme; Provisional
COG0296	GlgB	0.0	4	637	5	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK14706	PRK14706	0.0	37	597	41	587	glycogen branching enzyme; Provisional
PRK05402	PRK05402	0.0	4	638	99	724	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQP40138.1	0.0	1	657	1	658
CBL37815.1	0.0	1	656	1	657
QCP35773.1	0.0	1	652	1	658
QMW70941.1	0.0	1	651	1	657
BCD36168.1	0.0	1	651	1	657

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GQW_A	3.03e-185	8	595	132	736	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR2_A	4.28e-185	8	595	132	736	Crystalstructure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GR4_A Crystal structure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR5_A	4.28e-185	8	595	132	736	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQZ_A	6.05e-185	8	595	132	736	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQU_A	8.54e-185	8	595	132	736	Crystalstructure of branching enzyme from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQV_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltohexaose [Crocosphaera subtropica ATCC 51142],5GQY_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P30539	1.21e-208	5	604	7	604	1,4-alpha-glucan branching enzyme GlgB OS=Butyrivibrio fibrisolvens OX=831 GN=glgB PE=1 SV=1
Q21WG7	4.44e-205	9	597	6	586	1,4-alpha-glucan branching enzyme GlgB OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) OX=338969 GN=glgB PE=3 SV=1
Q1AZ86	1.99e-204	9	634	103	716	1,4-alpha-glucan branching enzyme GlgB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) OX=266117 GN=glgB PE=3 SV=1
B8CVY1	5.99e-204	9	636	10	626	1,4-alpha-glucan branching enzyme GlgB OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) OX=373903 GN=glgB PE=3 SV=1
Q8XPA2	2.98e-202	2	608	29	632	1,4-alpha-glucan branching enzyme GlgB 1 OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=glgB1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000065_00410.