CAZyme Information: MGYG000000065_00516

Basic Information

• Species: Anaerostipes sp900066705
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Anaerostipes; Anaerostipes sp900066705
• CAZyme ID: MGYG000000065_00516
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337	MGYG000000065_4|CGC1	40252.87	8.77

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000065	3036063	Isolate	United Kingdom	Europe

• Gene Location: Start: 10912; End: 11925 Strand: -

Full Sequence      

MASKHMNLKRVTKRVKEEFGSTIEIAKVLNIKDAVSTFRGKVDIQLMVHNGHKEWGWIKK
HLLKKHEVMNRYFDKTCPKLSDEKIRKLEKIELDEEYKDCIWICWWQGIDQAPYIVKKCV
DSIRKHAGNHKVIIITDKNYKDYVDFPEWLLEKKDKGIITKTHMSDLLRLKLLGQYGGIW
LDSTFYCTDSLEPYFESPIWSIKRPDYRHTSVACGYFANYSFGCQKEYRIVFNIIAEYLL
MYWKTNDYMIDYLFLDYLIVQAQRKHRMVREAFDLIEPNNPECDELLKILGNKYEEKVWC
QMKKETALFKLTWKANFPKEISGNETFYGKLVEDKLI

Enzyme Prediction     

No EC number prediction in MGYG000000065_00516.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	116	194	6.7e-24	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05704	Caps_synth	3.32e-77	58	331	10	278	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam04488	Gly_transf_sug	8.28e-04	116	193	4	85	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL39382.1	7.91e-246	1	337	1	337
AFC64057.1	6.79e-129	1	337	1	340
AQT55819.1	6.79e-129	1	337	1	340
APE39673.1	6.79e-129	1	337	1	340
QEX01936.1	6.79e-129	1	337	1	340

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000065_00516.