CAZyme Information: MGYG000000066_00522

Basic Information

• Species: GCA-900066755 sp900066755
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; GCA-900066755; GCA-900066755 sp900066755
• CAZyme ID: MGYG000000066_00522
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
879	MGYG000000066_3|CGC1	99991.91	4.8673

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000066	5871603	Isolate	United Kingdom	Europe

• Gene Location: Start: 24931; End: 27570 Strand: -

Full Sequence      

MEYHIDTAVKKTVRRGHLRMGGADPKGNGIEANSQYLTYNQRPWIPVMGEFHYSRNPVEY
WEEDLLKCKAAGIQVISSYVFWIHHEEEEGKFCFTGSRDIRKFVELCGKLGLGFFLRLGP
WVHGECRNGGHPDWIYEKCSHTRCNDETYLFYTKRLYTELAGQLDGLFFRDGGPIIGIQV
DNELIREPEHLGTLKKMARECGMEAPVWTVTGWGHHGGTRFPQDEFIPMFGGYPEGPWEQ
HMEPLAPSIHYQFREDRNDADIGVDVLALSDTQGYEGAADFSRYPFATCETGTGIPVTYH
RRPVIHPDDAGAMTLTGIGSGNNLVGYFMFKGGTNPKAGKTTYNETKDTGYLNNFPTLSN
DFQAPVSDFGEIRDVYKVLKRFNLFLGDFGEILAVAQPYFPADSADVADAAEAAEAAEAA
ETAEGTLIAEQHGDSENEGKLRYCVRDGEEGGFLFVNNYVRLERMPERKNTIVCIQRTGE
TIQIPLRIADRAGITIPADSYFFFPFALELGGSKLLYATAQPLCRYERKGKEFYLFYNPR
GMVSEYYFQDQLDAAFDPERMEKIRTEEGTLLRVRQAGMECMADVKTADGRIIGIITLSQ
EEADNCWKETEECRFLAEGYGDDGIPCESVYGEQKESRPGQDRALNDSGINRDARKRIVI
CKEELFFQDQKIHIRTAKPDGCIWILGNEGAANMERPGKEVVEKTGIQGNEKPENTKKLV
PIGKRGEFYGYAYETEERMCAAVVWKEELADEKLSVNYEYLRTEKTGGWDVRQWDIKLQL
PKISEGEDLILTVDYLGDAAHLYLGERLIADDYCKGIPWRIGLKRFYEELKEQKLTLLIL
PLAKEQPVYLERFPERREEELVRLGGIHAEWKKEVLLSF

Enzyme Prediction     

No EC number prediction in MGYG000000066_00522.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	37	381	1.7e-73	0.9837133550488599

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	1.21e-39	49	381	14	313	Glycosyl hydrolases family 35.
PLN03059	PLN03059	9.48e-21	37	380	37	343	beta-galactosidase; Provisional
COG1874	GanA	1.94e-12	49	196	20	173	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	4.57e-08	57	184	8	138	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK55023.1	4.32e-201	1	871	1	776
QJD87120.1	1.80e-198	1	866	1	774
QTH41311.1	1.51e-192	5	875	7	783
ADQ06026.1	7.16e-168	1	875	1	791
ADQ45200.1	1.64e-164	18	875	19	789

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KDV_A	2.90e-26	42	381	30	336	ChainA, Beta-galactosidase [Mus musculus],7KDV_C Chain C, Beta-galactosidase [Mus musculus],7KDV_E Chain E, Beta-galactosidase [Mus musculus],7KDV_G Chain G, Beta-galactosidase [Mus musculus],7KDV_I Chain I, Beta-galactosidase [Mus musculus],7KDV_K Chain K, Beta-galactosidase [Mus musculus]
3WEZ_A	7.26e-24	1	381	6	353	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]
3THC_A	8.88e-24	42	381	23	329	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
6EON_A	9.23e-24	30	202	28	204	GalactanaseBT0290 [Bacteroides thetaiotaomicron VPI-5482]
3D3A_A	9.99e-24	30	183	8	162	Crystalstructure of a beta-galactosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23780	1.72e-25	42	381	47	353	Beta-galactosidase OS=Mus musculus OX=10090 GN=Glb1 PE=1 SV=1
Q58D55	5.14e-24	42	183	45	187	Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 PE=2 SV=1
Q5R7P4	1.30e-23	42	381	46	352	Beta-galactosidase OS=Pongo abelii OX=9601 GN=GLB1 PE=2 SV=1
Q9TRY9	2.91e-23	32	381	38	353	Beta-galactosidase OS=Canis lupus familiaris OX=9615 GN=GLB1 PE=1 SV=3
Q9SCV9	3.29e-23	29	398	32	357	Beta-galactosidase 3 OS=Arabidopsis thaliana OX=3702 GN=BGAL3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000066_00522.