CAZyme Information: MGYG000000066_01246

Basic Information

• Species: GCA-900066755 sp900066755
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; GCA-900066755; GCA-900066755 sp900066755
• CAZyme ID: MGYG000000066_01246
• CAZy Family: GH93
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	MGYG000000066_7|CGC1	41529.33	4.4403

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000066	5871603	Isolate	United Kingdom	Europe

• Gene Location: Start: 1873; End: 2991 Strand: -

Full Sequence      

MKLQNNISWKKPVLINNEPLREDAGPDARQIHPGRFGSQYPRMVILEDGSWLAVYTVYRN
MGYLADPDGGNTLIIAVSNDGGTHWEETASLKDPGRDLDNGQLLLLPNGDILLACRSVIW
QQSYELPVYKSCDKGKTWERVSIIDENHGEPGRLGNPDRGVYEPHMLRLENGDVAVMYAS
EKYACADPPYSQVIVEKISTDGGLSWGAEIPVVFDKEKSEARPGMPVWDRLPDGRYLLVY
EVIATEGGDIFFKISENGIHWPEETGGRVPDQKGGPFIVSLHTGAVLVTSNTHHVSVTND
YGETWVRNQDSPWETLWMTEDNGATCTVKDGNVWPAMYELNDGSILYLTSVGREDGGNNI
QYRIGDLTYDEH

Enzyme Prediction     

No EC number prediction in MGYG000000066_01246.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	38	312	5.2e-67	0.9120521172638436

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.01e-12	5	253	121	336	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd15482	Sialidase_non-viral	5.88e-11	41	363	17	336	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	7.87e-08	78	240	87	227	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13088	BNR_2	0.004	23	174	145	278	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYQ75607.1	1.11e-119	13	367	34	372
AYQ73077.1	4.83e-118	6	367	380	732
QIP14490.1	8.47e-118	7	368	24	373
QHV93795.1	6.85e-117	6	368	23	373
AYQ71526.1	1.48e-115	13	367	34	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W5N_A	1.68e-10	40	241	30	228	ChainA, Alpha-l-arabinofuranosidase [Fusarium graminearum]
3A71_A	2.13e-10	40	359	25	342	Highresolution structure of Penicillium chrysogenum alpha-L-arabinanase [Penicillium chrysogenum],3A72_A High resolution structure of Penicillium chrysogenum alpha-L-arabinanase complexed with arabinobiose [Penicillium chrysogenum]
2YDT_A	2.99e-10	40	241	30	228	ChainA, Exo-1,5-alpha-l-arabinofuranobiosidase [Fusarium graminearum],5M1Z_A Chain A, Exo-1,5-alpha-L-arabinofuranobiosidase [Fusarium graminearum]
2YDP_A	1.27e-09	40	240	30	227	ChainA, Exo-1,5-alpha-l-arabinofuranobiosidase [Fusarium graminearum],2YDP_B Chain B, Exo-1,5-alpha-l-arabinofuranobiosidase [Fusarium graminearum],2YDP_C Chain C, Exo-1,5-alpha-l-arabinofuranobiosidase [Fusarium graminearum]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000066_01246.