CAZyme Information: MGYG000000066_02162

Basic Information

• Species: GCA-900066755 sp900066755
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; GCA-900066755; GCA-900066755 sp900066755
• CAZyme ID: MGYG000000066_02162
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
581	MGYG000000066_15|CGC1	65326.6	5.4198

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000066	5871603	Isolate	United Kingdom	Europe

• Gene Location: Start: 41214; End: 42959 Strand: +

Full Sequence      

MKMNNDGQSFFDMYGNNTRPAAEQDVRKRVYLCPRKILWQTEGEGAQVENSSALLLDRSV
QISLEAKNPCILRNNGKRAGVLLDFGMEIHGGIIISAWKESNGTGTKVRIRFGESAMEAM
SDIGDDKNATNDHANRDIVTNISSMSMTPVGETGFRFVRLDLLEEQAELVLKTVKAVLVI
KDVPYRGSFQCSDELLNRIWYTGAYTVHLNMQDYIWDGIKRDRLVWVGDMHPEITTIQAV
FGSDKSITRSLEFVKAETPLPGWMNGYPAYSMWWILILHDYFLHTNDLEYLKSNRDYLLG
LCDQLSASIDENGKDTTPQIRFLDWPSHADTVVVDAGLQALHTIATKKLKRIFQILGEKE
YELRCGEDLVKLRKYPADYKDSKQAAALLVMAGLLDADTANEKLLKAGGAKGMSTFMGYY
ILTARAMAGDLEGCLDCVREYWGGMLNLGATTFWEDFDVEWMEHAAPIDSLIKNPEEVDI
HGTFGRYCYKGYRHSLCHGWASGVTPWLTENVLGLKVLEPGCRLIEAEPKLGGLKWVRGS
FPTPYGEVRLSARQEEDGTIHAGVTAPDEVKIRKMPGICWE

Enzyme Prediction     

No EC number prediction in MGYG000000066_02162.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	80	571	2.5e-95	0.9742063492063492

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	9.55e-11	187	512	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.14e-06	514	577	1	74	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBM20341.1	6.87e-220	22	572	19	564
BBH21551.1	2.50e-218	24	572	9	555
QGQ98689.1	2.88e-215	21	572	6	556
QEC52590.1	2.03e-207	13	574	27	587
QMV41231.1	2.43e-206	23	572	6	555

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	2.60e-41	58	550	170	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	5.02e-07	192	458	212	509	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]
6GSZ_A	1.07e-06	154	546	397	810	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000066_02162.