CAZyme Information: MGYG000000066_03176

Basic Information

• Species: GCA-900066755 sp900066755
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; GCA-900066755; GCA-900066755 sp900066755
• CAZyme ID: MGYG000000066_03176
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
675	MGYG000000066_28|CGC1	80306.92	9.1074

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000066	5871603	Isolate	United Kingdom	Europe

• Gene Location: Start: 13832; End: 15859 Strand: -

Full Sequence      

MFIQWFRYCNILVLINLLKQEKSLLKKICNLIYIYEESKKKNEYLGWLLQKSKIERYNLF
YNKFKYEFIYYDNKENEDNNRIIDFDIINSDYIVFVNKNGKISKEFKRVISKYISKHKDS
QIIYTNEDEISSKKELIKYKNPFFKPEWSIDTLISYMYFGSCIIIKTDFIKKYFNTYTIK
SRADIYQLLLSLVWHKPIINRVEKILYHYSDLSNLLNENCIFEIANAKYRFLNHDINQKC
LLQLETNTKCYLPIYEHNINDMVSIIIPSKDNASILKVCILSILKYTKDLKYEIIVVDNG
SNKSCRKEIEDLSLAFNFKYYYEPMEFNFSKMCNYGVKKSQGNFILFLNDDIEVVQYNWL
NILIGQAKRPWTGAVGAKLLYPDKEHIQHIGITNGLNGPIHKLAMFRDDKDWCFGRNHLL
YNYIAVTGACLVIEKEKFINIGGFDEKLKIRYNDVDLGWRLYKKGYFNVVRNDVELIHCE
SISRGLDNDNNQKLEQLKIEKNLLFQNHKDFLNHDPLLSENIVQSKAGFDPDYCQDYDLN
KTNNIRKSNLVIKNQWIDDSINLYIEKVIDNKELIYIEGWSFLKSHDNSFYKKQIILRKE
PNFNTALIASVYFKYRNDIVDLYKAEKNIGLSGFICKIPRELIQKDIKYNIGILYTDKLN
KRKRFIASNNQILVK

Enzyme Prediction     

No EC number prediction in MGYG000000066_03176.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	264	385	4.4e-19	0.711764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	2.75e-28	265	478	1	164	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	3.46e-18	259	485	1	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	1.01e-14	264	385	1	121	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04184	GT2_RfbC_Mx_like	7.46e-13	110	208	104	199	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd00761	Glyco_tranf_GTA_type	2.04e-10	265	375	1	110	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVK48684.1	7.62e-118	87	672	779	1359
QUF73846.1	2.81e-117	87	672	779	1359
ABR36854.1	2.81e-117	87	672	779	1359
AIU02421.1	2.81e-117	87	672	779	1359
QWT52131.1	9.96e-99	86	658	475	1041

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	4.97e-39	92	534	451	903	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	2.98e-35	91	487	403	801	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P9WMY2	7.74e-06	426	487	183	244	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	7.74e-06	426	487	183	244	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999672	0.000323	0.000020	0.000000	0.000000	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000066_03176.