CAZyme Information: MGYG000000066_03179

Basic Information

• Species: GCA-900066755 sp900066755
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; GCA-900066755; GCA-900066755 sp900066755
• CAZyme ID: MGYG000000066_03179
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
782	MGYG000000066_28|CGC1	91058.81	6.3533

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000066	5871603	Isolate	United Kingdom	Europe

• Gene Location: Start: 21243; End: 23591 Strand: -

Full Sequence      

MDSIKNEIYELQESKALNMNCIIFMLNENHQYDFYNLLNIKYNYRCNFEFEIMCELSYPE
IKLVFNGLSSVIIKNFAIFDNQKECSFMFLNGVAGSEGQLFNNEIPQVQFICKNLDSCKK
IKISMDIISNGSTEFMEKYIFLSESYKALQGIINTLQQETHMLAQYKEKYESVTESTIWK
STKGLRLLLDKFKTSHYTRLLYKSLIVLKNEGFHSAIQRLKNRERIKVMNTAFVGEYDID
EGEANVQINKQMKRDIKFSIIVPLYNTKKEHLIEMIESVLKQTYGNYELCLADGSDKGHD
YINKIIKNYRNQYDNIKYIKISKNKGISGNTIEAFKLANGDFFVLLDHDDILTRNALFEL
VNVIHTNQYEADFIYSDRGIFDDGSKEVLAYHFLPGFSPDFMRACNYASHLNAFSKYIIE
QVGFIREGYDGSQDYEFELRVMEKARRVIHINKVLYYCRACEGSVALDPTSKMYAYEAGK
KAIEEHIARIGHKGKVEFLKDTFSYRIHYDINQADLVDIIIPNKNHLADLKRCINSILNK
TSYKNYMVTIVENNSSEKEVFEYYDEISKYANIRVLRFEINEFNFSAINNYAVSMSDGKY
VLFLNNDIEIINNDWLNEMLMFAQRDDVGAVGAKLYYPNDTNQHVGLLVGLGGHIASHYD
YGKNKNETGYMHRLTMPQNYDAVTAACLLVKKDDFVLVDGFDTVNFKIGLNDVDLCLKLR
ELGKYNIVTPYAEMYHYESASRGRDDSGEAKKRFEKETMLFREKWNKYFDLGSEYINPNY
KI

Enzyme Prediction     

No EC number prediction in MGYG000000066_03179.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	259	369	1.3e-24	0.6352941176470588
GT2	518	644	2.1e-20	0.7294117647058823

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	6.07e-71	257	460	2	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	8.29e-37	519	738	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.11e-22	519	744	7	227	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	2.49e-22	259	403	1	141	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	1.30e-21	259	459	1	194	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBX29992.1	2.02e-231	257	780	159	683
QMW89744.1	2.64e-180	175	779	8	604
BBK78193.1	2.64e-180	175	779	8	604
ACD24731.1	6.72e-177	163	779	477	1095
CDH92150.1	6.72e-177	163	779	477	1095

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MLZ_A	9.14e-06	254	349	21	113	Dolichylphosphate mannose synthase in complex with GDP and Mg2+ [Pyrococcus furiosus DSM 3638],5MM0_A Dolichyl phosphate mannose synthase in complex with GDP-mannose and Mn2+ (donor complex) [Pyrococcus furiosus DSM 3638],5MM1_A Dolichyl phosphate mannose synthase in complex with GDP and dolichyl phosphate mannose [Pyrococcus furiosus DSM 3638]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.97e-118	247	779	357	887	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.19e-64	251	750	314	806	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q077R2	3.15e-08	259	506	5	246	UDP-Glc:alpha-D-GlcNAc-diphosphoundecaprenol beta-1,3-glucosyltransferase WfaP OS=Escherichia coli OX=562 GN=wfaP PE=1 SV=1
A0A0H2UR96	1.21e-07	259	391	6	133	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
B5L3F2	3.41e-07	255	385	3	126	UDP-Glc:alpha-D-GlcNAc-diphosphoundecaprenol beta-1,3-glucosyltransferase WfgD OS=Escherichia coli OX=562 GN=wfgD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000066_03179.