CAZyme Information: MGYG000000066_03560

Basic Information

• Species: GCA-900066755 sp900066755
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; GCA-900066755; GCA-900066755 sp900066755
• CAZyme ID: MGYG000000066_03560
• CAZy Family: GH31
• CAZyme Description: Sulfoquinovosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
665		77079.95	5.0574

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000066	5871603	Isolate	United Kingdom	Europe

• Gene Location: Start: 40682; End: 42679 Strand: +

Full Sequence      

MQLVEKKDGFEIWQGNRILLAHSPKNPCFYVGRGEETVEMYRGNFQMEDYLTERIPLREA
VKEETAQPGVCRYRFQDRLLVEIAVCGDTATLHISGQADAGNRLWIRINGEKEEAVYGCG
EQMSYFNLRGRHFPLWSSEPGVGRDKSTYMTWRCDVENKSGGDYFNTNYPQPTYVSSRRY
FLHADTTVYADFDFRHEAYHELSFWGIPGQIRIQEADDFLSLMEKVTAYFGRQPRLPEWI
YRGAILGLQGGTKRVFDLVEQSLEKGIPVAGIWCQDWEGKRETSFGKRLQWEWRWDEKWY
PGLPEKIVEYEKKGIRFLGYINPYLVKDTPLYREGKENGYFAVDGRGGDYLVDFGEFDCG
VVDFTNPDAYEWFKGMIKKNLIDFGLSGWMADFGEYLPTDVSLFNGESAMVEHNHWPVLW
AKCNYEALEETGKLSELVYFMRAGGTGSQRYCPLLWAGDQCVDFSIHDGLASVICAALSA
AVMGNGLHHSDIGGYTSLYENVRTKEVFLRWAEMAAFTPVMRTHEGNRPDTNFQYYDDED
TMREFARLTRIHVALTPYLKDLVEENAVRGIPVQRPLFFHYENDPQTYQIQTEYLLGEDL
LVAPVYLSGKDEWEAYLPEDEWVHLWSGREYRKGKIKVAAKMGEIPVFYRKASRYRTLFE
NIAGR

Enzyme Prediction     

No EC number prediction in MGYG000000066_03560.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	218	651	3.2e-96	0.9718969555035128

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06594	GH31_glucosidase_YihQ	0.0	231	549	1	325	alpha-glucosidase YihQ-like. YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride. Orthologs of YihQ that have not yet been functionally characterized are present in plants and fungi. YihQ has sequence similarity to other GH31 enzymes such as CtsZ, a 6-alpha-glucosyltransferase from Bacillus globisporus, and YicI, an alpha-xylosidase from Echerichia coli. These latter two belong to different GH31 subfamilies than YihQ. In bacteria, YihQ (along with YihO) is important for bacterial O-antigen capsule assembly and translocation.
PRK10426	PRK10426	0.0	1	660	11	628	alpha-glucosidase; Provisional
COG1501	YicI	1.27e-152	1	650	16	665	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam01055	Glyco_hydro_31	2.53e-77	231	650	20	437	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06593	GH31_xylosidase_YicI	2.18e-57	231	548	1	304	alpha-xylosidase YicI-like. YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose. YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEY66974.1	0.0	1	662	1	660
ACR76323.1	0.0	1	662	1	661
CBK91527.1	0.0	1	662	1	661
QQO09502.1	0.0	1	665	1	663
QIX92903.1	1.74e-316	1	662	1	663

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PNR_A	0.0	1	662	1	661	ChainA, Alpha-glucosidase [[Eubacterium] rectale],6PNR_C Chain C, Alpha-glucosidase [[Eubacterium] rectale]
5AED_A	1.21e-266	2	662	12	675	Abacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AED_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEG_A A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5AEG_B A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5OHT_A A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12],5OHT_B A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12]
5AEE_A	6.95e-266	2	662	12	675	Abacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEE_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12]
5OHY_A	1.21e-265	1	662	1	660	ChainA, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]
5OHS_A	6.93e-265	1	662	1	660	ChainA, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_E Chain E, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_F Chain F, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_G Chain G, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_H Chain H, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_A Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P32138	5.01e-266	2	662	12	675	Sulfoquinovosidase OS=Escherichia coli (strain K12) OX=83333 GN=yihQ PE=1 SV=3
P31434	9.63e-50	102	630	148	643	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
B3PEE6	4.89e-43	114	632	152	647	Oligosaccharide 4-alpha-D-glucosyltransferase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=agd31B PE=1 SV=1
P96793	9.64e-42	113	632	157	647	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1
Q5AW25	1.94e-41	114	635	178	675	Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agdD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000066_03560.