CAZyme Information: MGYG000000066_04159

Basic Information

• Species: GCA-900066755 sp900066755
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; GCA-900066755; GCA-900066755 sp900066755
• CAZyme ID: MGYG000000066_04159
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	MGYG000000066_49|CGC1	44234.47	4.8706

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000066	5871603	Isolate	United Kingdom	Europe

• Gene Location: Start: 25387; End: 26547 Strand: +

Full Sequence      

MDFSQEYLNNQVWEDQPLSFGLPMQILEDGREIKAVTYTEPEGHVLFRLYAPGAADVVIC
CRYSRGHEIRIPLKAGTDGLFEGILPNREVYGGAQVVRVFMDQQEILSPYLPVCWVGNRP
ANFIEIPSAAGEDICIQAVPHGAVVREIFWSETLKSFQRCMIYTPPGYMNSEETYPVLYL
LHGGTCNELDWIYSGRLPYLLDNLIAGGKIAPFLVVMNNGMVRHEQTQAVWDDALEQMLV
RDNIPYIENRYRVSTGKWNRAIAGLSMGAYMTNDIGFRHPELFGYMGQFTACMTHKKDFP
NYKRPYHKVMAEAVQNPEAFAGNYKVFFRSTTPEEDYFEYFEADDEICKNAGIDKLPCSY
RIVFPENTSKIDSWRMGLRDFAQLIF

Enzyme Prediction     

No EC number prediction in MGYG000000066_04159.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	151	380	1.7e-40	0.9559471365638766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	3.92e-25	115	284	41	203	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	6.60e-14	151	337	1	192	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	7.09e-13	162	293	39	187	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG2819	YbbA	1.14e-06	162	287	27	166	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
cd02858	E_set_Esterase_N	5.36e-05	43	127	1	78	N-terminal Early set domain associated with the catalytic domain of esterase. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC66034.1	2.58e-57	20	386	17	360
CBK90399.1	2.02e-50	10	386	2	367
CBK94454.1	2.02e-50	93	386	83	367
QDV72866.1	1.09e-43	23	386	31	370
QDV77438.1	2.22e-42	23	386	31	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZO_A	1.35e-39	23	386	6	343	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	1.38e-39	23	386	6	343	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6MOT_A	1.02e-36	45	386	27	358	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6MOU_A	1.57e-36	45	386	48	379	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393],6MOU_B Chain B, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
7B5V_A	2.32e-35	45	386	48	385	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EY13	1.55e-31	16	287	377	650	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
D5EXZ4	1.43e-28	40	386	332	669	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P31471	1.80e-23	36	294	40	307	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
P10478	5.01e-22	116	291	23	197	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000066_04159.