CAZyme Information: MGYG000000067_01664

Basic Information

• Species: Lachnoclostridium_B sp900066765
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium_B; Lachnoclostridium_B sp900066765
• CAZyme ID: MGYG000000067_01664
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
508	MGYG000000067_8|CGC1	54781.8	9.5023

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000067	3710135	Isolate	United Kingdom	Europe

• Gene Location: Start: 10299; End: 11825 Strand: +

Full Sequence      

MKLVQSILTKNPCYTAGRKITVKGLMLHSVGCPQPKASVFINSWNSPSYNNACVHGFIDG
NDGTVYQTLPWNHRGWHCGSGSKGSGNNTHIGVEMCEPACIKYTSGSNFTCSDKATAKAV
AKRTYEAAVELFAMLCKQYNLNPTADGVIISHREGHSRGIASNHGDPEHLWNGLGMGYTM
DGFRKAVKAKMNGSGSSGSSTGTSGLQASALKNLSEADVIAKVGPLFTADQKTSGILASV
SLAQFILESGYGKSELAQNANNCFGMKKSLSGNTWSGSTWDGTSIYTKKTQEYENGAYMT
VTADFRKYPSVEKSIADHSAYLLGAKNGAKLRYDGLKGCTDYKKAVQIIKDGGYATSPTY
VENLCSIIEKWKLTQYDVANAGTAEVWYRVRKTWADAASQKGAFHSLANAKKCADENAGY
SVFDESGRNIYTGKQAAFQPYLVKVSASDLRIRKGPGIDKAKTGKYTGKGIFTIVEEADG
PGASKWGLLKAYQKNRDGWISLDHAQKV

Enzyme Prediction     

No EC number prediction in MGYG000000067_01664.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	224	373	6.1e-29	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.16e-43	220	380	47	191	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	5.03e-24	216	377	160	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
cd06583	PGRP	1.44e-22	22	167	2	123	Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20 kDa) extracellular proteins; intermediate PGRPs (PGRP-I) that are 40-45 kDa and are predicted to be transmembrane proteins; and long PGRPs (PGRP-L), up to 90 kDa, which may be either intracellular or transmembrane. Several structures of PGRPs are known in insects and mammals, some bound with substrates like Muramyl Tripeptide (MTP) or Tracheal Cytotoxin (TCT). The substrate binding site is conserved in PGRP-LCx, PGRP-LE, and PGRP-Ialpha proteins. This family includes Zn-dependent N-Acetylmuramoyl-L-alanine Amidase, EC:3.5.1.28. This enzyme cleaves the amide bond between N-acetylmuramoyl and L-amino acids, preferentially D-lactyl-L-Ala, in bacterial cell walls. The structure for the bacteriophage T7 lysozyme shows that two of the conserved histidines and a cysteine are zinc binding residues. Site-directed mutagenesis of T7 lysozyme indicates that two conserved residues, a Tyr and a Lys, are important for amidase activity.
PRK05684	flgJ	9.71e-20	232	383	168	309	flagellar assembly peptidoglycan hydrolase FlgJ.
pfam01832	Glucosaminidase	2.97e-19	224	318	1	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ98955.1	2.42e-274	1	508	1	539
AMP42248.1	8.66e-204	1	504	1	452
AFC63685.1	6.76e-190	1	508	1	498
ADL53623.1	4.92e-167	1	508	1	488
QJU15163.1	5.43e-133	1	436	1	486

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T1Q_A	1.62e-14	236	410	80	245	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3FI7_A	1.76e-13	232	377	46	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
2ZYC_A	1.57e-12	235	384	21	160	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	9.88e-12	235	384	21	160	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
3VWO_A	2.06e-11	235	375	20	150	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	5.86e-21	236	386	68	207	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q2G222	2.21e-13	236	410	340	505	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
P37710	2.36e-12	215	382	179	338	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
P39046	4.79e-11	214	384	60	221	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
Q9CIT4	7.47e-11	233	384	79	222	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000067_01664.