CAZyme Information: MGYG000000067_01784

Basic Information

• Species: Lachnoclostridium_B sp900066765
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium_B; Lachnoclostridium_B sp900066765
• CAZyme ID: MGYG000000067_01784
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
589	MGYG000000067_9|CGC1	67429.55	4.9414

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000067	3710135	Isolate	United Kingdom	Europe

• Gene Location: Start: 14650; End: 16419 Strand: +

Full Sequence      

MARKQTTKTAAKKKAPAKTTAKTTAKTTAKVTEKKAAVKAEEPKVEEVKAEEPKVEEPKT
EAVEEKKAEEPKAEAVEEKKVEEPKAEEPKVEEVKTEEPKTEEYMTPRRSIAFIGSECYP
FVKTGGLGDVMYALPKALVKQNCDVKVILPRYKCIPWEYQEKMVYKGAFEMNLCADGRSF
YVGIMEYVWDGVVYDFIDNEEFFGGGNPYTNLIDDIPKYCYFAKAALAALNYLDWIPDII
HCHDWQAALVPVYLRTLFEDTKISSAKTILTIHNLRFQGVYNIPTIRYWSGLPDYVFNKD
ALKVSYDDANMLKGGLTYSNIITTVSHTYAGEIQTPYYGENLDAHLRYHSGKLRGIVNGI
DYDIWNTSTDERLYENYDITNVIEKKKENKRKLQEELGLVQDEGKFVIGLISRLTNQKGL
DLVNEILPQIMDEYTQVVVLGTGDSVYEDSFRYYENAYKGNVCSNIMYDETRAHKIYAGA
DAFLVPSQFEPCGLTQLIAMHYGTVPIVRETGGLKDTVEPYNMFSNTGNGFTFDRYESGL
LLDAINRAKTLYFTERECWDEMVRRDMDKNFSWDNAAKQYKDLYLELTW

Enzyme Prediction     

No EC number prediction in MGYG000000067_01784.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	111	584	2.6e-175	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0297	GlgA	0.0	111	584	3	475	Glycogen synthase [Carbohydrate transport and metabolism].
TIGR02095	glgA	0.0	111	587	3	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK00654	glgA	0.0	111	587	3	463	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	111	586	2	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK14099	PRK14099	9.66e-116	105	588	1	480	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH27847.1	4.08e-293	107	588	265	746
QUC04956.1	4.06e-288	108	588	24	505
SDR77824.1	2.11e-274	108	588	269	750
BCL59191.1	8.08e-273	107	588	182	663
CBL39792.1	1.93e-271	107	588	77	558

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3D1J_A	2.73e-89	111	587	3	476	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	9.48e-89	111	587	3	476	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	7.30e-88	111	587	3	476	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
6GNE_A	3.14e-85	111	584	12	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
4HLN_A	4.37e-80	109	584	125	622	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C4Z0G2	1.90e-178	109	587	2	478	Glycogen synthase OS=Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4) OX=515620 GN=glgA PE=3 SV=1
A9KMA3	6.21e-164	109	587	2	478	Glycogen synthase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=glgA PE=3 SV=1
B2V049	2.67e-138	111	589	3	477	Glycogen synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) OX=508767 GN=glgA PE=3 SV=1
A6M334	3.90e-138	111	588	3	476	Glycogen synthase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) OX=290402 GN=glgA PE=3 SV=1
A0PY73	3.90e-138	110	584	2	472	Glycogen synthase OS=Clostridium novyi (strain NT) OX=386415 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000067_01784.