CAZyme Information: MGYG000000069_00880

Basic Information

• Species: Clostridium_A leptum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Clostridium_A; Clostridium_A leptum
• CAZyme ID: MGYG000000069_00880
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
237	MGYG000000069_2|CGC5	27687.54	9.1023

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000069	3099132	Isolate	United Kingdom	Europe

• Gene Location: Start: 117346; End: 118059 Strand: -

Full Sequence      

MSIPKKIHYVWVGGQPKSKDIQACMKTWRKHLGDYEIIEWNEKNFDIDSSLFVRQAYEQK
RWAYVSDYIRAYAVYHYGGIYLDTDVLVLDDLTRFLDHRAFVGFENSKYPFTAAFGAEPG
HPLVKDMLDFYEGKSFVFNSQDQLSQTNTRSVSDILIEKYDCQVNNQFQVLREDIAVYPD
GVLCNPSAQSSTIHVFTGTWMDGKKPLARKLIKRLKLRLTTSKRADLYNRIIRRDRS

Enzyme Prediction     

No EC number prediction in MGYG000000069_00880.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	21	97	3.1e-20	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	2.41e-17	3	132	82	215	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	2.10e-11	24	101	7	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	7.07e-09	21	132	65	189	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	3.20e-05	43	87	146	195	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam12919	TcdA_TcdB	0.004	5	44	1	39	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAR34957.1	1.19e-118	3	231	2	230
QAS49963.1	1.69e-118	3	231	2	230
ASN61482.1	2.40e-118	3	231	2	230
QPG03656.1	4.60e-116	3	231	2	230
QGR95881.1	9.91e-113	3	231	2	230

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000069_00880.