CAZyme Information: MGYG000000069_01888

Basic Information

• Species: Clostridium_A leptum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Clostridium_A; Clostridium_A leptum
• CAZyme ID: MGYG000000069_01888
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1776	MGYG000000069_5|CGC1	193293.02	4.0966

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000069	3099132	Isolate	United Kingdom	Europe

• Gene Location: Start: 1195; End: 6525 Strand: +

Full Sequence      

MEDRNVAHTVYVSTTGNDDTGDGSQGKPFATIEKAKEHVRTLDKDSGDIVVKIAGGLYEL
EDTIVFDENDSGNENCTIYYEAVDGEEPIISGGKLLEGDWEEATEVDWLDDGIKAYKTDL
VRNDKLRAIYVNGERASMTRRSARPLRSVGNYSVTKGEADWAWISKSGIKEGNVFAADFG
LPADTRNPQNIELESGSTWVKAIVCADTLEETPEGDTQVNFQMPYAAIAQQPSWNCNYNP
TGNNDVVNVFEWLSEPGEFYFDQAGSTLYYIPKEGEDMADAEVIIPELVTLVDIKGSTPK
QDYAAHITFRGLTFAYSDWNLAEVDGSHGNATVQGCTYMNKFSTGNWHDDMYRSYDVAPA
AVHATSAHDIAILDGKIEMTGYLGFHAENDVYNIEVTGNYIGHTGGGGVTIGHPQHVYEN
DTEEHWVGGSGSNNAGPDKEKFQNGTEAVPKNIYIRNNYFLENCYFFPGCSPIATYFTQN
MWIEHNFIYKCSYSAMSIGWGWCNFDGEVGSDSQLPGLPTTTSRNNHVNYNRIEDYASIL
QDCGGIYTLGQQGDGTPGGTDYSQYSEFNGNYINVYRETPDWVNEGRWINGFHPDEGSAY
ILFDSNVITNTLRNVYEMNNWRRKHDLVVTNGFSNSSKSETTAPNCSLDQYVSAESIWPK
AGNNVVLNSGLEDEYTYLIDETVMPDSYYELASNVRLSAGDTLNRRGLLEADDEVWLAPA
GTKDFAEGPTMTKAAGNEKTITVPMELGEYKLYIKYANGQVSDASEFTVYVGESKDLANV
AEGQNYSVSELKPLVLELDTDNYTFTLNGEKIKNGHSISTEASWELKATPIGESEATKTI
TFTTSVSLANKLLPKNLTVSPEGLVEFAEALNDAGYSIWLAESGLSAFDENDPRQSYAAG
DSASMKAPKTPGTYVLSVTKADDKTQIDSQSDAKVRVLNMVTAGNGLATYGTPTIGEGET
DPIWNSAPALVIEKHLTMKDNGTASGVAKAMWDEENLYVMVEVQDPVLNSDSSQVHEQDS
IEIFVDETNCKASSYQAGMGQYRINYKNEQTFNGSGIEEGFESYARIVDGGYVIEAKIPF
KTVDPAANDKIGFDVQINDANADGTRQDIVMWYDETGNSWQSGANWGEVTLEEKSPIPTN
GLNIWLNADRGVTLGGDDGDSVLSWENQGSMDATFTAEAETAPTLGVNENGVPSLVFSGG
KDDQGTLGGDGDFMTFDGVDFNNKSEMTMIVVSHYTGKSVGNPSGDWTSGDKYCAIFAEE
AGGWGSLFMSPYHDWTSARFGTGKDFCNIKYYDRDEIDRTAVTIATKDGAKEKLYVDGVL
GAEKNDAVAVTKNIGSKMHIGASYSDYKWTYFKGTISEILIYDRALSDAEIEQVNTYLTQ
KYVTSLESITVSGPTKTQYEIGDELDLTGLVVTAHYSDGSEAAVEDYEVSGFDSSTAGEK
TITVTYQDKTTTFTVNVKEAAPVVTLESITVSGPTKTEYEIGDELDLTGLVVTAHYSDGN
EKVLSAGDYEVSGFDSSTAGEKTITVTYQDKTTAFTVNVKEAAPVVTLESITVSGPTKTE
YKIGEELDLTGLVVTAHYSTGDEATVTGYEVSGFDSSTAGEKTITVTYQGKTAAFKVTVK
ETEKPVVTLESITVSGPNKTEYKIGEELDLTGLVVIAHYSDGSYQEVTDYEVSGFDSAAA
GEKTVTVTYQGETVSFKITVKEDIASSEQPGESGKPDDNQSSSQPDDTQSGSGSQDDQNI
QTGDSMAPYVGVAIVLILLSGLGVAIALIIRRRRLG

Enzyme Prediction     

No EC number prediction in MGYG000000069_01888.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	9	610	5.4e-115	0.9924098671726755
CBM9	958	1131	7.5e-51	0.9835164835164835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00005	CBM9_like_1	4.71e-88	948	1132	4	185	DOMON-like type 9 carbohydrate binding module of xylanases. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. The CBM9 domain frequently occurs in tandem repeats; members found in this subfamily typically co-occur with glycosyl hydrolase family 10 domains and are annotated as endo-1,4-beta-xylanases. CBM9 from Thermotoga maritima xylanase 10A is reported to have specificity for polysaccharide reducing ends.
pfam06452	CBM9_1	7.51e-59	958	1132	3	182	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.
cd09619	CBM9_like_4	3.67e-19	964	1127	12	187	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
pfam07523	Big_3	3.40e-14	1555	1619	1	67	Bacterial Ig-like domain (group 3). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in a variety of bacterial surface proteins.
pfam07523	Big_3	1.17e-13	1473	1539	1	67	Bacterial Ig-like domain (group 3). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in a variety of bacterial surface proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWI67019.1	0.0	10	937	148	1078
ACL75355.1	1.90e-299	6	1249	44	1686
AUX40294.1	1.00e-141	11	760	19	720
QNU65850.1	2.96e-140	6	771	40	755
ALX09871.1	7.59e-138	9	803	44	779

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1I82_A	3.35e-45	948	1131	5	187	Family9 Carbohydrate-Binding Module From Thermotoga Maritima Xylanase 10a With Cellobiose [Thermotoga maritima],1I8A_A Family 9 Carbohydrate-Binding Module From Thermotoga Maritima Xylanase 10a With Glucose [Thermotoga maritima],1I8U_A Family 9 Carbohydrate-Binding Module From Thermotoga Maritima Xylanase 10a [Thermotoga maritima]
7NWN_AAA	1.03e-29	949	1140	26	214	ChainAAA, Beta-xylanase [Caldicellulosiruptor kristjanssonii I77R1B],7NWO_AAA Chain AAA, Beta-xylanase [Caldicellulosiruptor kristjanssonii I77R1B],7NWP_AAA Chain AAA, Beta-xylanase [Caldicellulosiruptor kristjanssonii I77R1B],7NWQ_AAA Chain AAA, Beta-xylanase [Caldicellulosiruptor kristjanssonii I77R1B]
5MQP_A	1.33e-29	7	606	24	580	Glycosidehydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_B Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_C Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_D Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_E Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_F Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_G Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_H Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron]
2L7Y_A	3.28e-06	1628	1700	5	81	Solutionstructure of a putative surface protein [Streptococcus pneumoniae]
4FDW_A	4.89e-06	1474	1539	32	98	Crystalstructure of a putative cell surface protein (BACOVA_01565) from Bacteroides ovatus ATCC 8483 at 2.05 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q60042	3.64e-40	914	1131	842	1053	Endo-1,4-beta-xylanase A OS=Thermotoga neapolitana OX=2337 GN=xynA PE=1 SV=1
Q60037	6.37e-40	894	1131	829	1057	Endo-1,4-beta-xylanase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=xynA PE=1 SV=1
C6CRV0	1.40e-39	943	1154	865	1080	Endo-1,4-beta-xylanase A OS=Paenibacillus sp. (strain JDR-2) OX=324057 GN=xynA1 PE=1 SV=1
P38535	1.81e-38	948	1134	714	897	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1
P36917	7.09e-37	948	1134	862	1045	Endo-1,4-beta-xylanase A OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
1748	1770