CAZyme Information: MGYG000000070_03388

Basic Information

• Species: Lawsonibacter sp900066825
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Lawsonibacter; Lawsonibacter sp900066825
• CAZyme ID: MGYG000000070_03388
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
686	MGYG000000070_17|CGC1	78479.5	6.5049

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000070	3806775	Isolate	United Kingdom	Europe

• Gene Location: Start: 16114; End: 18174 Strand: -

Full Sequence      

MVKYNGKLSEYDLFLELEAFSEGRSCHAWRCFGAHPCRKDGQEGYLFRVWAPNARQVCVF
GDFNGWDENAAPLEKLEGGIWEGFLPGLKRYDTYKYVIHAADGTVTAKADPYAFHAETRP
GNASKIYELDEYPWGDAGWMDYRAKNPPYRRPMNIYECHLGSWRRTGEGEFLSYRDTARY
LVPYVKEMGYTHVELLPVMEHPLDASWGYQVTGYFAATSRFGTPDDLKYLIDQLHQAGVG
VILDWVPAHFPRDAFGLYHFDGTPTYEYADPRKGEHPDWGTQVFDLGRNEVRSFLFSNAM
FWLEEYHADGLRVDAVSSMLYLDYGRQDGAWMPNIHGGNENLEAIEFFQKLNTTIFAAHP
DVLMIAEESTAWPKVTYPVDEGGLGFNFKWNMGWMNDICHYIKLDPYFRQFNHRDITFSL
MYAFSENYILPLSHDEVVHMKGSFLGKMPGENSEKFAGVRAFYAYMLTHPGKKLSFMGAE
LGQWNEWHYEYSLDWHLLQYEPHRQIHKFFQAANAFYLAEPALWEQDDSWQGFQWLCADD
HTANTVAFLRWDREGRPLIVVCNFSPIHRKGYYVGAPFSGAWAPVLNTDAAEFGGSGLGD
TAPIKTISTPCHDQEQALSIDLPPMSVMVYRCIRRSPVRKKKAGEKAPEKKSFPKTGAGK
TASAKTAARRSKAAARPGRKPKTDQA

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	183	483	2.5e-157	0.9966777408637874
CBM48	32	116	1.2e-17	0.8947368421052632

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	6	635	5	630	1,4-alpha-glucan branching protein GlgB.
PRK14706	PRK14706	0.0	32	649	27	638	glycogen branching enzyme; Provisional
PRK14705	PRK14705	0.0	15	625	606	1215	glycogen branching enzyme; Provisional
COG0296	GlgB	0.0	7	631	5	627	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK05402	PRK05402	0.0	8	631	100	722	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALP95322.1	0.0	17	642	18	643
QBB67031.1	0.0	17	642	18	643
QQR06902.1	0.0	17	656	10	658
ANU40328.1	0.0	17	656	10	658
QIA32147.1	0.0	17	649	10	651

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GQW_A	1.34e-234	8	631	129	772	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR5_A	1.90e-234	8	631	129	772	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQZ_A	2.68e-234	8	631	129	772	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQU_A	3.80e-234	8	631	129	772	Crystalstructure of branching enzyme from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQV_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltohexaose [Crocosphaera subtropica ATCC 51142],5GQY_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR1_A	7.62e-234	8	631	129	772	Crystalstructure of branching enzyme Y500A/D501A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142],5GR6_A Crystal structure of branching enzyme Y500A/D501A double mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8DLB8	2.79e-250	7	638	105	756	1,4-alpha-glucan branching enzyme GlgB OS=Thermosynechococcus vestitus (strain IAM M-273 / NIES-2133 / BP-1) OX=197221 GN=glgB PE=3 SV=1
Q2JT08	3.14e-245	8	631	117	752	1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain JA-3-3Ab) OX=321327 GN=glgB PE=3 SV=1
Q30Z14	3.32e-242	8	631	14	636	1,4-alpha-glucan branching enzyme GlgB OS=Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20) OX=207559 GN=glgB PE=3 SV=1
O66936	5.03e-242	8	631	7	627	1,4-alpha-glucan branching enzyme GlgB OS=Aquifex aeolicus (strain VF5) OX=224324 GN=glgB PE=3 SV=1
Q1AZ86	1.50e-241	8	631	99	718	1,4-alpha-glucan branching enzyme GlgB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) OX=266117 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000070_03388.