CAZyme Information: MGYG000000071_00670

Basic Information

• Species: Pseudoflavonifractor capillosus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Pseudoflavonifractor; Pseudoflavonifractor capillosus
• CAZyme ID: MGYG000000071_00670
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
816	MGYG000000071_3|CGC4	88330.61	6.3586

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000071	3913719	Isolate	United Kingdom	Europe

• Gene Location: Start: 84657; End: 87107 Strand: -

Full Sequence      

MKYADLIAKMTLEEKCSLLSGEGNFTTKSVKRLNIPGMFLSDGPHGLRKQAGAADHLGLN
ASLPATCCPTAATMANSWDPELGEELGKMLGEEAKAQGVSVLLGPGLNMKRSPLCGRNFE
YFSEDPYLAGKMAAAYIRGIQSQGVAACPKHFAANSQETLRMHSDSVVDQRTFREIYLTG
FEIAVKEGHPQSIMSAYNRINGKYANEDKELLRDILVDQWGFDGFVVTDWGGSNDRAEGL
KCGNALEMPATGGNSDRELVAAVKAGTLSEDVIDQRLDEYLNVLFATVIPADAPKEFDVD
AHHATARKAAESTIVLLKNEDNILPLKAGTSVAVIGDFAQTPRYQGAGSSMVNPTKLDCA
LSVIKSGSGLKLVGFEPGFIRHGGADEAKKNAAVELAKNAEIVLMYMGLDEISESEGLDR
KHMKIHQNQVDVLEAVAKVNPNVVVVLSGGAPIEAPWLDSCKAVVHGYLGGQAGAGAVVD
VLTGKVNPSGKLAETWAMKYEDTPAYRHFPGTEATAEYREGLYIGYRYYQTAQVPVRFPF
GYGLSYTTFAYADLRADDKSVTFTVTNTGSVPGAEIAQVYVSRKGGVVFRPEQELKGFVK
VFLNPGECKTVTVELDDKAFRYFNVKTGKFEVESGDYEIRVGASCADIRLTATVAVKGTD
APAPYDLSKLPSYCSGKVSDVGDTEFEYLLGRPIPPAKWDRSAPLGMNDTFSQLFYAKRW
IGRLVYAILTHLKNKAEAKGTPDLNILFIYNMPFRGVAKMMGGAFDMDMSAALVEIFNGH
FFKGVGHLLSARSRMNKAKKATDLALAQAGNVKGEN

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	28	267	4e-67	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	9.52e-82	4	649	39	758	beta-glucosidase BglX.
COG1472	BglX	1.44e-70	32	356	57	377	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	4.76e-58	314	546	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	8.47e-52	6	642	56	769	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	5.29e-38	32	283	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCN29197.1	0.0	1	801	2	803
AZK48658.1	0.0	1	803	1	807
QRT31068.1	0.0	1	800	1	801
QEI32524.1	0.0	1	800	1	801
QHB25014.1	0.0	1	800	1	801

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	6.69e-228	6	659	8	671	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.19e-187	10	666	12	673	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.35e-132	2	656	3	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	2.06e-131	2	656	3	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	1.49e-118	6	648	9	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	3.66e-227	6	659	8	671	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	4.40e-186	7	664	9	680	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	4.38e-183	7	664	9	680	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	3.25e-130	1	653	44	742	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q5BFG8	3.71e-126	6	648	14	830	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000071_00670.