CAZyme Information: MGYG000000071_01427

Basic Information

• Species: Pseudoflavonifractor capillosus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Pseudoflavonifractor; Pseudoflavonifractor capillosus
• CAZyme ID: MGYG000000071_01427
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
251	MGYG000000071_6|CGC1	27931.72	4.7621

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000071	3913719	Isolate	United Kingdom	Europe

• Gene Location: Start: 78950; End: 79705 Strand: -

Full Sequence      

MLQEFIEFGFNGWYAPSMNMHRSPFGGRNFEYYSEDSLLSAEMAVAECQAAYDHDVYPYI
KHFAFNEQEINRNGMLCTWLTEQSAREIYLKPFEACVKASNGNTLAVMSSYNYVGTTWAG
ACSALLNDILRGEWGFQGMVLTDYFGNYGYMDADKAIRGGSDAMLGTAGNDAILTDQTSA
TSVLAMRNACHNILYTVANSRAYSPEVYMEATAMPAWQVTVFVVDGVLAAILIVLEALTL
RGYLKKKKVRT

Enzyme Prediction     

No EC number prediction in MGYG000000071_01427.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	3	164	1.3e-42	0.7407407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	2.73e-26	3	174	107	278	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	5.44e-16	1	146	110	257	Glycosyl hydrolase family 3 N terminal domain.
PRK15098	PRK15098	7.58e-13	9	144	150	288	beta-glucosidase BglX.
PLN03080	PLN03080	1.57e-09	13	167	153	332	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR03979.1	1.64e-106	4	248	188	428
ARE65116.1	1.64e-106	4	248	188	428
AFN84568.1	4.98e-105	3	248	817	1058
ANY69911.1	8.03e-100	1	251	720	966
QGM63589.1	1.14e-80	12	250	192	425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2X40_A	1.21e-28	1	145	103	244	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.41e-27	1	145	103	244	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
5WUG_A	5.85e-24	15	145	622	749	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
3AC0_A	1.14e-20	15	162	100	241	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
5WAB_A	6.83e-20	15	144	107	233	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5BFG8	6.09e-29	15	156	105	243	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
A1DNN8	1.31e-27	15	156	108	246	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
P27034	3.23e-27	15	148	97	227	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
P16084	3.24e-27	3	174	632	797	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
Q5AV15	3.26e-27	15	156	129	267	Probable beta-glucosidase J OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
216	238