CAZyme Information: MGYG000000072_02139

Basic Information

• Species: UBA1394 sp900066845
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1394; UBA1394 sp900066845
• CAZyme ID: MGYG000000072_02139
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
692		76355.89	4.7429

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000072	2648835	Isolate	United Kingdom	Europe

• Gene Location: Start: 18666; End: 20744 Strand: +

Full Sequence      

MEKYFDSTLSAEERAIALTDAMTVEEQASQLRYDAPAVKRLGIPAYNWWNEGLHGLARSG
IATMFPQAIGLAAMFDTELTQKVADIIAEEARAKYNAYTKYDDRDIYKGLTFWAPNINIF
RDPRWGRGHETYGEDPYLTAENGKAFVNGLQGEGKTMKAAACAKHYAVHSGPEAVRHEFN
AEVSKRDIEETYLPAFEALVREAHVEGVMGAYNRVNGEAACASSFLMSKLNEWGFDGYFV
SDCWAIRDFHEHHGLTANPVESAALAIKSGCDVNCGCTYAYLLAALNEGLITEEHIRNAC
IHLMRTKIRLGMFDDKTEYDDIPYTVVSCKEHKAVSLKCAEKSMVLLKNNGILPLDESRL
HTIAVIGPNSDSRIALEGNYNGTADKYVTFLDGIRERFDGRVIYAEGCHLYKDKVSALAQ
SGDRYAEALAAADCADLVVLCVGLDSTIEGEEGDTGNEFSSGDKNDIRLPEYQRILVDKI
MQTGKPVVVVCAAGSSVNTECDPDALIHAWYPGSEGGTALAEILFGDVSPSGKLPVTFYE
RSDMLPDFTDYSMKNRTYRYAENNVLYPFGYGLTYGKIVCTSVEYKDGKAVVTAENTSGK
AVDDVIQLYIKDYCENAVPNVSLCGFKRVNLAAGEKIFVEISVSERAFTAVDENGERNRF
GSRFTLYAGTHQPDEISEKLCGTKCVSTEINL

Enzyme Prediction     

EC	3.2.1.37	3.2.1.-	3.2.1.21	3.2.1.55

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	37	275	7.8e-70	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN03080	PLN03080	3.30e-140	6	657	44	757	Probable beta-xylosidase; Provisional
PRK15098	PRK15098	3.07e-102	5	647	81	729	beta-glucosidase BglX.
COG1472	BglX	1.36e-76	6	410	21	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	6.55e-59	344	575	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.56e-48	26	305	46	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE64772.1	0.0	1	691	1	690
ADU23372.1	0.0	1	691	1	690
CCO04977.1	0.0	1	690	1	689
CBL17962.1	0.0	1	686	6	691
CBL34024.1	0.0	1	692	1	691

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VC7_A	8.10e-111	14	670	25	719	ChainA, xylan 1,4-beta-xylosidase [Phanerodontia chrysosporium]
7VC6_A	8.10e-111	14	670	25	719	ChainA, xylan 1,4-beta-xylosidase [Phanerodontia chrysosporium]
5Z87_A	1.41e-89	2	656	34	758	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5A7M_A	2.68e-87	6	682	44	755	ChainA, BETA-XYLOSIDASE [Trichoderma reesei],5A7M_B Chain B, BETA-XYLOSIDASE [Trichoderma reesei]
5AE6_A	2.73e-87	6	682	44	755	ChainA, BETA-XYLOSIDASE [Trichoderma reesei],5AE6_B Chain B, BETA-XYLOSIDASE [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EY15	1.90e-146	4	680	24	857	Xylan 1,4-beta-xylosidase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyl3A PE=1 SV=1
Q94KD8	3.15e-119	13	657	53	738	Probable beta-D-xylosidase 2 OS=Arabidopsis thaliana OX=3702 GN=BXL2 PE=2 SV=1
Q9SGZ5	7.01e-117	14	575	48	625	Probable beta-D-xylosidase 7 OS=Arabidopsis thaliana OX=3702 GN=BXL7 PE=2 SV=2
Q4WFI6	1.88e-113	6	666	44	738	Probable exo-1,4-beta-xylosidase bxlB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bxlB PE=3 SV=1
B0Y0I4	1.88e-113	6	666	44	738	Probable exo-1,4-beta-xylosidase bxlB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bxlB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999955	0.000075	0.000004	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000072_02139.