CAZyme Information: MGYG000000073_01194

Basic Information

• Species: GCA-900066905 sp900066905
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; GCA-900066905; GCA-900066905; GCA-900066905 sp900066905
• CAZyme ID: MGYG000000073_01194
• CAZy Family: GH55
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
972		107650.92	5.0052

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000073	2615710	Isolate	United Kingdom	Europe

• Gene Location: Start: 536931; End: 539849 Strand: +

Full Sequence      

MQSSKSFYLQAPKDSRAAYLTPENFPVRGDGVNDDTLGIQAAINQVKDEMGYGIVFIPEG
TYRITRTLYVPKAVRLIGYGQNRPTLVLDDNAPGFDQDDPEDKGQSKYLLWYVDRVPKLG
EAVRDANAGTFYSALVNVDLRLGQGNPSAVALRTHFAQHSFIAHVDIHVESGRAGMFDAG
NEMEDVRFFGGDYGIISTRTSPSWPFVMVDTAFYGQRKAALRTQEVGLTAIRTHVKDTPV
FAETPDGFYEKLYVEDSVLENISDTALVISLEDNSVGQINLRNVACHNVPTLARFRESGK
VCAGQAGDYHVTRFTHGLVQEGLGAYEEMRTICELSALSAPPVMPESDIPALPPVSAWVN
LKELGAKGDNCTDDTDVLEAALLKYDCLYLPQGWYIVTRPLKMRPGTKLIGLNPISTQLV
VPDNCEAFGDVGAPLPLLEVAPGGQNILFGIGLNAGANNPRIVGCKWSAGKGSYMNDVKF
VGGHGTMGWDGQNQPSYNANRTADPDIDRVWDYQYWSLWVAGGGGVFKDIWTASTFAAAG
FYASDTHIPSRIYAMSIEHHCRNEVKFKNVRNWKVYGLQTEEEVAESRHCQPLELRDCVD
MLFANTYLFRVIWLYNPYPYAITTEGCRDIEFANVHNFTQVKYTMDNLLYDRTSGLEVRP
WQLSSLILGEKAEKRPPVTCPAVLNGLPQKLAGGFEFPDAITADQKGNVYFSESRMRRIY
RWDAAAQTLKLIWDAPFKPLGLAVDTLGNLLVACEFIIPKGATQGGRPVVGDKPNEPTSY
GTWYRADAVVRMYAIDPEKPEESVRPLPLLDMQRVDKVARAYYPGNRWRDSNDYLQKAVE
PCEKCFVAPDGVTIIPYCYDLIRMSTLSPATPGAPFYAVDEYLKRTVRFDVDAKGALSNP
QVVAERGEYSVAQDACGRLFVPNGQLYVYEADGMPIGWVDCPERPSCVAFGGADGNTLYM
TTRSGFYAIALA

Enzyme Prediction     

No EC number prediction in MGYG000000073_01194.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	19	583	2.4e-87	0.7824324324324324

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12708	Pectate_lyase_3	2.66e-16	28	195	10	169	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
pfam08450	SGL	8.84e-10	697	962	1	244	SMP-30/Gluconolaconase/LRE-like region. This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species. These proteins include various enzymes, such as senescence marker protein 30 (SMP-30), gluconolactonase and luciferin-regenerating enzyme (LRE). SMP-30 is known to hydrolyze diisopropyl phosphorofluoridate in the liver, and has been noted as having sequence similarity, in the region described in this family, with PON1 and LRE.
COG3386	YvrE	2.18e-09	707	962	37	274	Sugar lactone lactonase YvrE [Carbohydrate transport and metabolism].
pfam12708	Pectate_lyase_3	1.30e-06	358	411	1	60	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
cd05819	NHL	2.66e-06	692	753	145	212	NHL repeat unit of beta-propeller proteins. The NHL(NCL-1, HT2A and LIN-41)-repeat is found in multiple tandem copies, typically as 6 instances. It is about 40 residues long and resembles the WD repeat and other beta-propeller structures. The repeats have a catalytic activity in Peptidyl-glycine alpha-amidating monooxygenase; proteolysis has shown that the Peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL) activity is localized to the repeats. Tripartite motif-containing protein 32 interacts with the activation domain of Tat. This interaction is mediated by the NHL repeats.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU28861.1	0.0	4	967	9	976
QEM14394.1	0.0	5	969	21	984
AYL99405.1	0.0	2	971	22	996
QPH57852.1	0.0	6	971	26	1003
BBK89258.1	0.0	6	971	26	1003

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EQN_A	1.16e-18	23	448	53	490	ChainA, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
5M5Z_A	6.86e-14	12	445	21	470	ChainA, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
7CHU_A	3.92e-06	23	82	78	143	ChainA, Putative pectin lyase [Geobacillus virus E2],7CHU_B Chain B, Putative pectin lyase [Geobacillus virus E2],7CHU_C Chain C, Putative pectin lyase [Geobacillus virus E2]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000073_01194.