CAZyme Information: MGYG000000073_01209

Basic Information

• Species: GCA-900066905 sp900066905
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; GCA-900066905; GCA-900066905; GCA-900066905 sp900066905
• CAZyme ID: MGYG000000073_01209
• CAZy Family: GH2
• CAZyme Description: Evolved beta-galactosidase subunit alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1019	MGYG000000073_2|CGC4	114199.96	6.1446

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000073	2615710	Isolate	United Kingdom	Europe

• Gene Location: Start: 559473; End: 562532 Strand: +

Full Sequence      

MAKDLENIAVLSAGRLPSRATMYPYAREEAALTFQRELSPYFKLLSGVWAFRYAENAGGF
SPAEVLDTSAVETLKWDETPVPSCWQMQGYGRNQYTNIRYPFPVDPPYVPDQNPVGFYRR
AFRLPAAFAGRRVHLHFDGVAGFFYVYLNGSRVGFSQGAHLPSEFDITAFLREGDNYLDV
VVFQWSFASYLEDQDMWRMNGIFRDVYLTAQGPVYLADVYTRTAFEGRDGVLHITPAMAG
NKDTTGYTLSAKLYGPRGQLAASGSFASLQEEMTLRVPDVTPWNCEVPALYTLVLALEGP
SGLQQISPLRIGFKEVAVHDGQLWVNGVSVKLKGVNRHDFSPDRGYAVTFEEMERDVRLM
KQYNINTVRTSHYPNDPRFLDLCDRYGLFVIDECDIETHGMEEVGNVSAISDDAAWQQAY
LERAHRMVLRDRNHPSVIIWSLGNESGHGQNHVAMAQAIRSLDPTRPIHYEGGYDSAELD
IVSRMYATLEECIRQGAQVKDARPFFQCEYAHAMGNGPGHLKDYWDAFYRYPRLIGGCVW
EWADHGIRVRDEGGASHFAYGGDFGEYPHDGNFCIDGLCSPDRVPHESLKAYKWIIQPVH
ITAAHPEQGRITVENRHFFRDLGYLTPSWSLRVDGRAVASGALAPLYIGPGENRELELPF
PERLPIPGVWSLQVSFALAQDTLWAHAGHRVAFQQFLLPDTAAAPQLPLAALPSMQTQSD
GRVLTVTGTDFTARFDLMKGNLCALGYQGLDLIAQGPTPNFWRAPTDNDAHAIEEMWRKA
GLDRLQIRKRDCSWHYNKDGTITVCACARLAAAACPPVADIISTYTVYGNGDIDLKVDFR
PQDYLPYLPRMGVTLALDPALENLTYLGLGPGQTYCDLKENASFGLWRSTVSQQYVDYIR
PQEYGNHYDTRMLALLSPHGLGLAVIARQPFEFSARHHTDAQLEKATHDVSLARSEQVIL
SLDAAQGGLGSNSCGPEPLPQHRLYPKRRQLHVLLRPVHLSHGDLPAFCRALPPERDTL

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	32	883	1.8e-227	0.9720744680851063

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	0.0	3	985	15	1018	beta-galactosidase.
PRK10340	ebgA	0.0	2	985	1	987	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	2.53e-169	37	885	7	807	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	5.72e-119	316	601	1	302	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
smart01038	Bgal_small_N	1.30e-91	727	995	1	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE96523.1	0.0	1	997	1	1007
BBH86227.1	1.34e-294	3	997	10	1009
QDS36994.1	1.77e-285	4	997	6	1016
ATF16364.1	1.00e-284	4	997	6	1016
QQT02343.1	1.58e-284	2	997	5	1034

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SD0_A	1.10e-219	1	987	1	972	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6S6Z_A	2.13e-219	4	987	3	971	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6ETZ_A	2.94e-183	2	987	8	977	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB [Arthrobacter sp. 32cB],6H1P_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB - data collected at room temperature [Arthrobacter sp. 32cB]
6SEB_A	5.29e-183	2	987	29	998	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB in complex with IPTG [Arthrobacter sp. 32cB],6SEC_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cBon complex with ONPG [Arthrobacter sp. 32cB],6SED_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB in complex with galactose [Arthrobacter sp. 32cB]
1YQ2_A	5.53e-183	45	997	36	1023	ChainA, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_B Chain B, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_C Chain C, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_D Chain D, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_E Chain E, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_F Chain F, beta-galactosidase [Arthrobacter sp. C2-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	6.05e-219	1	987	1	972	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
P06864	1.92e-218	6	1007	5	1007	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
O52847	1.64e-214	7	988	23	1023	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
P70753	2.86e-196	11	984	13	986	Beta-galactosidase OS=Actinobacillus pleuropneumoniae OX=715 GN=lacZ PE=3 SV=1
Q7MG04	2.04e-185	45	997	50	1028	Beta-galactosidase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000073_01209.