CAZyme Information: MGYG000000073_01969

Basic Information

• Species: GCA-900066905 sp900066905
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; GCA-900066905; GCA-900066905; GCA-900066905 sp900066905
• CAZyme ID: MGYG000000073_01969
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
277	MGYG000000073_5|CGC1	30739.76	4.971

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000073	2615710	Isolate	United Kingdom	Europe

• Gene Location: Start: 24992; End: 25825 Strand: +

Full Sequence      

MALITLNFFSQALNRTVPCNVVIPSDKVVARGAEAAPRGPYKTLYLLHGILGNYTDWVAG
TRVQALANAHDLCVVMPSGDNKFYCDSDLSGDYYARFIGQELVEFTRATFNLSTRREDTY
IAGLSMGGFGALVNGLRNMDTFSHIAAFSAALIKDRILGAVEEAGHDFFTRAQYCTLFGL
QKVADFEGCPWDYDALARAAGPLQDKPRIYMACGTEDGLFAANTAYRDLLEAQGFTVTWR
QERGGHDWNFWDRAIEWVMDWLPLGEAVRGISSENVK

Enzyme Prediction     

No EC number prediction in MGYG000000073_01969.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	10	261	1.5e-48	0.973568281938326

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	1.17e-26	32	263	45	309	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG2382	Fes	1.29e-20	40	255	97	288	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	2.01e-18	10	251	1	235	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
PRK10439	PRK10439	6.64e-07	198	251	341	395	enterobactin/ferric enterobactin esterase; Provisional
pfam10503	Esterase_phd	4.57e-05	36	149	11	129	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VTS04162.1	8.36e-16	3	255	61	284
VIP03395.1	8.36e-16	3	255	61	284
QLG39149.1	1.47e-15	36	255	106	306
ADY36651.1	2.71e-15	41	251	181	384
QNU66652.1	3.35e-15	6	255	60	274

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RGY_A	9.16e-47	1	264	2	263	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
4ROT_A	7.39e-37	1	264	8	259	Crystalstructure of esterase A from Streptococcus pyogenes [Streptococcus pyogenes]
2UZ0_A	1.29e-36	2	264	6	254	TheCrystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_B The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_C The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_D The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae]
7L0A_A	2.41e-31	1	262	9	258	ChainA, Esterase family protein [Staphylococcus aureus],7L0A_B Chain B, Esterase family protein [Staphylococcus aureus]
6VH9_A	1.13e-30	2	262	4	252	FphF,Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VHD_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHE_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6WCX_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23553	1.02e-59	1	262	1	261	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
P10478	3.67e-13	4	255	52	269	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EXZ4	1.97e-06	21	255	449	661	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
B1LIP0	4.78e-06	9	149	20	169	S-formylglutathione hydrolase FrmB OS=Escherichia coli (strain SMS-3-5 / SECEC) OX=439855 GN=frmB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999272	0.000766	0.000009	0.000001	0.000001	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000073_01969.