CAZyme Information: MGYG000000074_00204

Basic Information

• Species: Alistipes onderdonkii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes onderdonkii
• CAZyme ID: MGYG000000074_00204
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
466		52388.58	5.2985

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000074	3211686	Isolate	United Kingdom	Europe

• Gene Location: Start: 269352; End: 270752 Strand: -

Full Sequence      

MKKFAFLLFSAATVLFCGCSTSPKEGYSIVDGVIVFDVPARAEGQHSVLRLTVDPIPVVR
VGFIGLGMRGPGAVERFANIDGVEIVALCDLYPERVDKSQEILTGHNLPAAAPYSGEEGW
KELCRRDDIDLVYICTPWQLHVPMAVYAMEHGKHVAVEVPAAMSLDECWQLVDTAEKTQR
HCMMLENCVYDFFELTTLNMAQHGLFGEILHTEGSYIHNLEPYWDYYQGNWRLDFNQSHR
GDVYATHGLGPACQLLDIHRGDKMNYLVAMDTKSVNGLKLAKEKMGAETFANADQTLTLI
KTERGRTILLEHNVYTPRPYSRMYQLTGTEGFANKYPVEGYAFRPEQIAGEEIPDHENLS
EHSFIPQAAKAALMERYKHPIARDIEEKARRVGGHGGMDFIMDYRLVYCLQHGLPLDQDV
YDAAEWSCIGSLTAASLEHNSMPVAVPDFTRGDWDKVDGFRHAMAQ

Enzyme Prediction     

No EC number prediction in MGYG000000074_00204.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	56	455	9.7e-163	0.9874686716791979

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	6.61e-25	59	407	4	325	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	2.25e-17	59	184	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	5.72e-06	128	213	64	149	putative oxidoreductase; Provisional
COG4091	COG4091	1.19e-04	59	155	18	129	Predicted homoserine dehydrogenase, contains C-terminal SAF domain [Amino acid transport and metabolism].
pfam03447	NAD_binding_3	1.26e-04	61	181	2	112	Homoserine dehydrogenase, NAD binding domain. This domain adopts a Rossmann NAD binding fold. The C-terminal domain of homoserine dehydrogenase contributes a single helix to this structural domain, which is not included in the Pfam model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL01207.1	0.0	1	466	1	466
BBL11909.1	0.0	1	466	1	466
BBL09117.1	0.0	1	466	1	466
AFL77663.1	2.18e-317	1	466	1	465
BBL06379.1	9.75e-287	1	465	1	464

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	8.71e-91	59	454	43	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	3.15e-68	59	454	21	431	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E18_A	1.88e-13	64	354	11	271	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]
3E82_A	1.48e-09	56	216	10	155	Crystalstructure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]
5A02_A	5.53e-09	64	209	12	154	Crystalstructure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A03_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A04_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A05_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A06_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C863	1.43e-228	38	466	33	464	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1
Q5LGZ0	1.43e-228	38	466	33	464	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1
A6KX96	1.65e-224	1	466	2	471	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1
Q7MWF4	4.65e-221	34	466	33	468	Glycosyl hydrolase family 109 protein OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=PG_0664 PE=3 SV=2
Q89ZX8	1.41e-217	19	466	17	467	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000073	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000074_00204.