CAZyme Information: MGYG000000074_01813

Basic Information

• Species: Alistipes onderdonkii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes onderdonkii
• CAZyme ID: MGYG000000074_01813
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424	MGYG000000074_3|CGC9	48258.34	4.4926

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000074	3211686	Isolate	United Kingdom	Europe

• Gene Location: Start: 649641; End: 650915 Strand: +

Full Sequence      

MRKSLFRWTVAMLTLSAAAVSGACSEQEYEDLTKPEKVTGNTQYAPYTIDWTEAADSCST
AFIERFYCSENRNGYEGVFSYREYNATGSANSNNYWQQAHAMAAMVEYYNRIKATDAEEK
ARIEGYFQKWYDKRGNNYEGNQNWRGSTGFGNDFTDDTCWIIIALFQMYDATGNQTYYDA
AKQTWDECVWPRHELTQSGWLPWKWSDLGPNECTNGPAAIAAATLAQYSRAAGNEEAAQE
YIDQACTCFDQNIDVMASDGTLGSTPLSYTQGTCMEAGRLLWKLTGDTGYLRKAIQAGRG
QMTSTRMNEVYNYEMVSRDEGTDENNSIFHAVMFHWFTRMILDTEVDSFDGKIRKELYDY
LYRHASYYWATIDKTPEGWPEAYFGVKCYQPRSSMNGDVGGSLGAYTSAAQAIESMWMIK
DVKF

Enzyme Prediction     

No EC number prediction in MGYG000000074_01813.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	82	391	9.8e-34	0.8324022346368715

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	9.73e-07	60	376	24	317	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	0.006	95	294	35	244	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL11270.1	0.0	12	424	1	413
BBL08478.1	0.0	12	424	1	413
BBL00494.1	0.0	12	424	1	413
QUR45011.1	4.26e-50	1	416	1	381
AFL76820.1	1.27e-46	12	419	5	401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	2.46e-12	94	352	87	333	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	4.40e-11	94	352	88	334	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	2.46e-10	94	352	88	334	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
4C1S_A	1.25e-07	151	294	102	261	Glycosidehydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
4BOK_A	1.48e-07	94	314	37	255	ChainA, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000209	0.109012	0.890641	0.000051	0.000053	0.000038

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000074_01813.