CAZyme Information: MGYG000000074_02062

Basic Information

• Species: Alistipes onderdonkii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes onderdonkii
• CAZyme ID: MGYG000000074_02062
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
981		109759.34	6.8626

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000074	3211686	Isolate	United Kingdom	Europe

• Gene Location: Start: 214054; End: 216999 Strand: +

Full Sequence      

MKHLILMLSALVAVSAGRAQVAVHEKSPKTKYAFTLASPRQTAAILYDASDAAVVKRAAE
LFAADVEAVTGRRPQVTSATGETGPAVIVGTVGGSALIRRLSEAGKIDTAPLEGAWERYL
IQTVANPLPGIRKALVIAGSDRRGAAYGLFTLSELIGVSPWYWWADVPVKKHAALHVDAP
PTYSQTPSVRYRGIFLNDEDWGLTPWASQTFEPERGNIGPRTYAKVCELLLRLKANYLAP
AMHPVSTSFNQIPENKLVADTFAIVMGSTHCEPLLLNTASEWDTQTMGPWNYDKNKEGIN
RVLTQRVRENSPYENVYTLALRGLHDGAMSTTLPMHEKVRMLQQALLDQRQILAENIDRP
VETVPQAFTPYKEVLEIYSNGLELPDDVTIVWPDDNYGYMKRLSGVREQRRTGRSGVYYH
VSYLGVPHSYLWFSTTPPSLMYEELRKAYDTTADRLWLLNCGDLKGSEMQVSLFLDMAWD
IGRFTADNVVTYPARWLAGIFGEAYYDRLEAMTREHLRLAFPRKPEYMGWGYHWNRFDHN
CEQLTDTDFSFTNYDEAPRRLEAYRKLGARAEALLHEIGDEARPAFYQLVYYPLRGAELM
NRMTLGGQRNRWYARQGRAATNAVRDEVQRCYDSLQVITRGYNSLLGGKWNHMMSMRQNY
DGVSAYFNLPHLATHDAAGAPRLALQVAGEDVTGARAFHALPAFDNYLRRTYPVEIYNRG
GGTLAWTAHASEPWVVLSKSAGKTADEERITVGIDWEKAPSGNAVPAQIVFRAGEQSEKV
LVSLFNPTAPSRAELRGIYVENNGCVSIPAAGCHRVRENDRIKITAVEDLGIEGPALQLG
DPTAPLQIFRSRDVPCAEYDFYAFDAGSVDVYTYVLPTFPLHADRDFRIGENTNTDTKYS
VQIDDGALATPSSSHVEYSQVWFESVLRNCAVNKSTLHIDKPGRHTLRIRVGDPGIVLQK
IVLDFGGMKRSYLGPQSTLIE

Enzyme Prediction     

No EC number prediction in MGYG000000074_02062.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	33	658	5.8e-231	0.8220946915351507

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	1.10e-162	185	526	1	333	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	1.41e-48	799	975	2	170	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	3.75e-04	58	152	37	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).
cd14948	BACON	4.55e-04	725	783	27	81	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL11629.1	0.0	1	981	1	981
BBL08837.1	0.0	1	981	1	981
BBL00912.1	0.0	1	981	1	981
ANQ62807.1	0.0	1	979	1	980
CUA17176.1	0.0	1	979	1	980

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	3.01e-156	36	975	16	930	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
5BY3_A	3.00e-133	41	651	26	612	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4C90_A	7.67e-113	45	654	55	640	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	5.92e-101	87	658	69	629	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	1.55e-100	87	658	68	628	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000498	0.998697	0.000284	0.000171	0.000165	0.000155

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000074_02062.