CAZyme Information: MGYG000000074_02138

Basic Information

• Species: Alistipes onderdonkii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes onderdonkii
• CAZyme ID: MGYG000000074_02138
• CAZy Family: GH164
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
669	MGYG000000074_4|CGC6	74123.21	6.8089

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000074	3211686	Isolate	United Kingdom	Europe

• Gene Location: Start: 327724; End: 329733 Strand: +

Full Sequence      

MKKIILLLALGFLCQPLYPQRTEYPQIGAQVFIEPGQTDKQIDGFFRILAQHGFETARIR
MFGAHMLRPDGSWDFTLYDKAFDAAGKHGVKLFATLFPPTDELGDVGGFKFPRSKAHLLE
IAGYIEAVVSHFRGHPALDTWVLQNEPGTGGTGPGRNDLTDEVFARWKAAQKTPAYDNGY
LKADFTQERFHTDFTTWYLGWIASQVDLHDPAHHKHINPHQLLDNLADYDFPAYEGFLTS
LGVSMHLSWHFGYFTRAQYPLGISLMADIIRSGAGKNPFWITEMQGGNVTASGREVLCPT
AREITQWLWTGIAAGAEGVIFWTLNQRASALEAGEWGMLDFQGRPSDRLTAASEVARTAK
AHKSFFREARPVRSGITLLYNTESLRTQQKNAAVSDDGRYEGRKASATMKSLAGAYEAIA
AWGVVPEVCEMDAYDWSDPQGKTIVLTNLVALPSGAWERLDDFVRKGGRMIATGLTGFYD
QNMHCILMDDFPLRRCFGAQISEYKAVAPYFTIACDTPATTLPAHLWKGILTPDKAQAIA
MHGDDVVGTRHRYGKGEAVWLPSLIELGGWHGDNKGVADFYGTYCRGQIDRAPLHFSRPA
DGVLMRLMESPSQRLAVLVNKRPHAVEIGLSRALPASARRLCGEASPEGASVRLGAEECA
VFLWDKQAE

Enzyme Prediction     

No EC number prediction in MGYG000000074_02138.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH164	1	665	0	0.9955223880597015

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08532	Glyco_hydro_42M	1.43e-18	416	566	36	189	Beta-galactosidase trimerisation domain. This is non catalytic domain B of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. This domain is related to glutamine amidotransferase enzymes, but the catalytic residues are replaced by non functional amino acids. This domain is involved in trimerisation.
COG1874	GanA	4.52e-13	46	561	36	586	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	6.43e-12	46	348	16	361	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
cd03143	A4_beta-galactosidase_middle_domain	2.15e-06	424	487	44	100	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.
COG5520	XynC	2.40e-04	2	324	7	309	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL08914.1	0.0	1	669	1	669
BBL11706.1	0.0	1	669	1	669
BBL00989.1	0.0	1	669	1	669
AFL78174.1	1.82e-266	20	666	20	659
VEI54061.1	5.33e-177	1	664	24	687

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T5O_AAA	1.49e-153	25	621	31	627	ChainAAA, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T5O_BBB Chain BBB, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T5O_CCC Chain CCC, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T5O_DDD Chain DDD, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T5O_EEE Chain EEE, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T5O_FFF Chain FFF, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T6G_AAA Chain AAA, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T6G_BBB Chain BBB, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T6G_CCC Chain CCC, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T6G_DDD Chain DDD, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T6G_EEE Chain EEE, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T6G_FFF Chain FFF, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T75_AAA Chain AAA, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T75_BBB Chain BBB, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T75_CCC Chain CCC, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T75_DDD Chain DDD, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T75_EEE Chain EEE, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T75_FFF Chain FFF, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T7G_AAA Chain AAA, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae CL02T12C01],6T7G_BBB Chain BBB, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae CL02T12C01],6T7G_CCC Chain CCC, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae CL02T12C01],6T7G_DDD Chain DDD, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae CL02T12C01],6T7G_EEE Chain EEE, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae CL02T12C01],6T7G_FFF Chain FFF, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae CL02T12C01],7OMI_AAA Chain AAA, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],7OMI_BBB Chain BBB, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],7OMI_CCC Chain CCC, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],7OMI_DDD Chain DDD, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],7OMI_EEE Chain EEE, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],7OMI_FFF Chain FFF, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],7OMS_AAA Chain AAA, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],7OMS_BBB Chain BBB, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],7OMS_CCC Chain CCC, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],7OMS_DDD Chain DDD, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],7OMS_EEE Chain EEE, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],7OMS_FFF Chain FFF, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae]
5E9A_A	1.67e-09	128	563	164	620	Crystalstructure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_B Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_C Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_D Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_E Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_F Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003856	0.769486	0.225637	0.000271	0.000362	0.000348

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000074_02138.