CAZyme Information: MGYG000000075_01009

Basic Information

• Species: Paraclostridium tenue
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Paraclostridium; Paraclostridium tenue
• CAZyme ID: MGYG000000075_01009
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
298		34455.64	9.9048

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000075	3140683	Isolate	United Kingdom	Europe

• Gene Location: Start: 976690; End: 977586 Strand: +

Full Sequence      

MSKKRILLGFVVLLIIIAIAFFIKMFNLREINKKEIDVEKFIKCTDQVSYSKAQVNWKYV
ASIIGVLDDNKFKNVSNNQIKEIANLFIIKDKDTYKIEPLKNVLSKLKFNKREIKRVNKY
VGDLKYYGLKPSRLNPDGKYMAFIDSIENSAIDNYKNYKILPSITIAQAILESNWGESEL
SSKYNNLFGIKAHSSWKGDSVNIETSEFYNQVINDQFRAYKSKADSIKDHAKFLSENPRY
KGVFNKPTYIEQAQELQNSGYSTVSDQSGNLTYKKLLNQIIEQYNLQLIDSKVQEIKG

Enzyme Prediction     

No EC number prediction in MGYG000000075_01009.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	149	286	6.5e-39	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.11e-54	141	290	44	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK05684	flgJ	1.94e-30	162	283	174	296	flagellar assembly peptidoglycan hydrolase FlgJ.
smart00047	LYZ2	1.38e-28	138	288	6	143	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	1.20e-24	151	230	4	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
NF038016	sporang_Gsm	1.95e-23	142	286	162	308	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEK38266.1	1.77e-156	1	298	1	298
AUN14464.1	6.05e-156	1	298	6	303
QYE96518.1	1.45e-155	1	298	1	298
CEJ73790.1	1.45e-155	1	298	1	298
QEZ67673.1	2.27e-145	1	297	1	297

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	3.33e-23	142	290	32	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	3.93e-18	164	272	27	142	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	4.00e-18	164	293	27	155	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	2.81e-16	142	263	3	131	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	3.43e-16	142	263	4	132	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	2.01e-26	142	298	50	206	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	2.04e-16	142	263	162	290	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
P15931	2.23e-16	164	293	176	304	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
Q9CIT4	9.17e-16	142	290	64	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P0C2T5	2.25e-15	142	290	64	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.888394	0.106322	0.003501	0.000347	0.000215	0.001224

TMHMM  Annotations     

start	end
7	26