CAZyme Information: MGYG000000075_02120

Basic Information

• Species: Paraclostridium tenue
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Paraclostridium; Paraclostridium tenue
• CAZyme ID: MGYG000000075_02120
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
486	MGYG000000075_3|CGC1	55392.06	9.4301

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000075	3140683	Isolate	United Kingdom	Europe

• Gene Location: Start: 31345; End: 32805 Strand: -

Full Sequence      

MGKSISKEKNVLDTEDSYDVVFLENILNKSTVRENVSGTIDTALLLDKIHSKIYLNVKTK
FFLSIIVAVMWSLISFQLSKNWISDLAVITSPFFAIFIIGGIAYVPGFMNAFLISSLLLD
KQPKIKEPTMVEDDVTLLISAYNEEAGIFNTLKYVKNQNYNGKIHVIVIDNNSNDNTSLE
VERAMKELDMDILLLKEPKPGKFNALNYGLKHVKTEFVITLDADTLINKNSIAYLVSRMK
ASSSDVCAVAGSMLVRNSRDNLLAKIQEWDYFLSIASIKRMQGLYQGTLVAQGAFSLYRT
DIVSRLGGWSDAIGEDIVLTWKMLAESKRVYFEPMAVAFTDVPTKLSHFVKQRSRWARGM
IEGLREVKPWQQPSMFCKFSTGIDLVIPYMDFSYTFFWIPGLFLALFFKNYAIVGPMMMF
VLPLTLISFGVLYYYQSTVVFKTLNLKVRKNLMGFILFILFYQMIMSPVSLYGYIQEVLG
TKRVWK

Enzyme Prediction     

No EC number prediction in MGYG000000075_02120.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	134	359	9.5e-27	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	4.01e-52	137	316	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	3.50e-44	82	485	3	419	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	9.22e-39	93	485	9	411	N-glycosyltransferase; Provisional
PRK14583	hmsR	6.11e-32	135	483	77	427	poly-beta-1,6 N-acetyl-D-glucosamine synthase.
cd06439	CESA_like_1	8.40e-30	111	363	7	251	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEJ73509.1	1.18e-255	38	486	8	456
QYE99472.1	1.95e-254	38	486	8	456
CEK38003.1	3.22e-253	38	486	8	456
AUN14224.1	7.53e-252	45	486	15	456
QOK29384.1	5.72e-193	50	485	16	449

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SP7_A	2.41e-13	188	359	161	346	ChainA, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
7SP6_A	9.88e-13	188	359	161	346	ChainA, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP8_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP9_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SPA_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
5TZE_C	6.13e-06	136	249	4	118	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	8.25e-06	136	249	4	118	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7A351	1.05e-32	119	359	35	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1
Q5HCN1	1.05e-32	119	359	35	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q6GDD8	1.05e-32	119	359	35	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q9RQP9	1.05e-32	119	359	35	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaA PE=3 SV=2
Q99QX3	1.05e-32	119	359	35	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999797	0.000174	0.000008	0.000001	0.000000	0.000028

TMHMM  Annotations     

start	end
61	78
93	115
385	407
412	434
454	476