CAZyme Information: MGYG000000075_02949

Basic Information

• Species: Paraclostridium tenue
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Paraclostridium; Paraclostridium tenue
• CAZyme ID: MGYG000000075_02949
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
148	MGYG000000075_12|CGC1	17038.16	7.1988

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000075	3140683	Isolate	United Kingdom	Europe

• Gene Location: Start: 232; End: 678 Strand: -

Full Sequence      

MIESEAKKSYKKYGILPSITVGQAILESGWGQSELTKNSNNLFGIKSDESWKGKSVEVNT
TENYSDIVKAKFRKYDSIEESIKDHAKFLKENKRYKQHGLFEGNDYKEQAQSLENAGYST
KKNQSGELIYADMLIDLIERYNLFLMDK

Enzyme Prediction     

No EC number prediction in MGYG000000075_02949.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	5	143	8.5e-41	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.93e-48	2	143	50	184	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK05684	flgJ	1.36e-35	6	140	163	296	flagellar assembly peptidoglycan hydrolase FlgJ.
pfam01832	Glucosaminidase	2.40e-29	6	85	4	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK12712	flgJ	4.06e-27	6	120	208	327	flagellar rod assembly protein/muramidase FlgJ; Provisional
NF038016	sporang_Gsm	6.50e-27	6	147	171	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEK39773.1	1.39e-81	2	148	72	218
CEJ75314.1	2.80e-81	2	148	72	218
AUN13203.1	2.80e-81	2	148	72	218
QYE98430.1	8.02e-81	2	148	72	218
QEZ68765.1	6.63e-75	2	147	72	217

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.32e-17	2	143	37	179	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	6.25e-17	6	128	14	141	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	8.59e-17	6	128	14	141	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5T1Q_A	1.86e-11	2	147	67	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	5.34e-24	2	143	55	194	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9KQ15	1.18e-18	6	141	172	312	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q9X9J3	8.81e-17	6	136	171	306	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
P15931	3.35e-15	6	128	163	290	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
P75942	8.62e-15	6	140	160	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000009	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000075_02949.