CAZyme Information: MGYG000000075_03083

Basic Information

• Species: Paraclostridium tenue
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Paraclostridium; Paraclostridium tenue
• CAZyme ID: MGYG000000075_03083
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	MGYG000000075_17|CGC1	39503.62	9.5396

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000075	3140683	Isolate	United Kingdom	Europe

• Gene Location: Start: 6752; End: 7831 Strand: -

Full Sequence      

MSSVDSLLNGSKLNKKLLTLFFSSCGLTFILLILLLTVIVGVISSNNNKSNDIEYTSSLN
IPPEVERYRSVVQLECNANGVPELVDVVLALITQESYGRLADIMQSSESQGLPPGTITDP
NLSIKVGVKYFAGVYRNAKEKASKNVIETTLQGYNFGIGFVNWAIKRDGGWTQENAIEFS
RIHSNGSQRSNGTYRYGDQLYVQHVYRYLTPNEGNNKVNLGSSSNNLVIEKAIKSGSSWI
GRSSYGMGWGRNQSDIASGRFDCSSFVHFAFNQAGFSLGNVANTNTDTLVNKGKRVDISK
AKRGDLVFFDTYKINGHVGIYLGNGQFLQCSDSKGVNISSLSNSYWKRVFKGVIVRVIE

Enzyme Prediction     

No EC number prediction in MGYG000000075_03083.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16891	CwlT-like	7.25e-61	68	209	1	150	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam13702	Lysozyme_like	9.34e-52	62	209	1	165	Lysozyme-like.
pfam00877	NLPC_P60	3.52e-28	261	355	14	105	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
COG0791	Spr	1.43e-20	176	353	20	196	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].
PRK10838	spr	1.44e-17	262	351	93	179	bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEZ70805.1	3.62e-164	1	357	1	363
AWX74641.1	3.59e-141	57	359	66	368
AVI31007.1	3.59e-141	57	359	66	368
QTG87454.1	3.59e-141	57	359	66	368
API45191.1	5.09e-141	57	359	66	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HPE_A	5.60e-33	50	348	9	298	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
4FDY_A	1.21e-30	59	347	20	301	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
2K1G_A	3.82e-12	262	348	32	115	SolutionNMR structure of lipoprotein spr from Escherichia coli K12. Northeast Structural Genomics target ER541-37-162 [Escherichia coli K-12]
3PBI_A	1.49e-07	238	335	101	192	ChainA, Invasion Protein [Mycobacterium tuberculosis]
3NE0_A	1.21e-06	261	332	123	189	Structureand functional regulation of RipA, a mycobacterial enzyme essential for daughter cell separation [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96645	5.19e-51	52	347	45	319	Probable endopeptidase YddH OS=Bacillus subtilis (strain 168) OX=224308 GN=yddH PE=3 SV=1
Q65NQ9	5.82e-43	223	359	318	452	Peptidoglycan DL-endopeptidase CwlO OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=cwlO PE=3 SV=1
P40767	2.26e-42	229	359	343	473	Peptidoglycan DL-endopeptidase CwlO OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlO PE=1 SV=2
O34636	3.07e-19	68	205	55	200	Uncharacterized membrane protein YocA OS=Bacillus subtilis (strain 168) OX=224308 GN=yocA PE=4 SV=1
P45296	7.21e-13	224	350	62	176	Probable endopeptidase NlpC homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=nlpC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	42