CAZyme Information: MGYG000000076_00840

Basic Information

• Species: Roseburia intestinalis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia intestinalis
• CAZyme ID: MGYG000000076_00840
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
770	MGYG000000076_5|CGC5	87952.22	5.3843

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000076	4318260	Isolate	United Kingdom	Europe

• Gene Location: Start: 137834; End: 140146 Strand: +

Full Sequence      

MGEKVKKKGTWDARWLTIPEFADALPVNLFHKEQVQPAFEGEKTAEFQNVHVFVRGHFTL
ERAQKIFCKVTADDHYKAYLDGAFMGEGPAAAYHTKYYYNVLELGTFAAGEHVLALHLYY
QGLVNRVWNSGDLRFAFAAELWDEKGKEIPVSFCFLKTDCYEGETVGYETQFLENFDSRK
YPYGWKNTGFDADGWEKPVPAVWADYTLTKQPTEMLSYMEYQLGTIKLHAGNEHPLEPTK
LHSDAVQPLEPAKLEHKCADHNGHIHQITPSVIRQDPDGSMLLDAGEEITGMILLTAEGK
DGDQVKLFYGEELDGKGSVRYDMRCNCCYREIWTLADGRCEFDPYDYKGFRYVKIVPDGG
VKLSDIRFLVRHYPMDESLCELKTEEKTLENIFQICKNAVRLGTQENYVDCPTREKGQYL
GDAVVTAHAQVLLTGKTDMLLKCIDQFAQTARVCPGLLAVAPGGLMQEIADFSLLYSQLL
LLYYRFTGEKETVDRYYGIADGILKHFSQYAREDGLLEQVADKWNLVDWPENLRDGYDFP
LTRPVVALGCHNVINALYIGAMETQNTLAEICGREMPYQTKEIKKAYRNAFYREKTGLLA
DSETSSHAALHSNVYAMYFHLLPEADEEKILTFMKQKGFSCGVMLSYFVLRVFAERGQYD
MVYELLVNEGEHGWVNMLREGATTCFEAWGKDQKWNTSLCHPWASAPIPILIEEIAGVHI
DAAEKGRYYWTPHIPKEIREFRLCVPVKGKKIIVEKKMGEAYAVIREDKE

Enzyme Prediction     

No EC number prediction in MGYG000000076_00840.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	273	755	4.1e-93	0.9503968253968254
CBM67	47	199	3e-19	0.875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.20e-30	381	709	5	334	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	9.42e-07	274	355	1	84	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	0.001	70	214	10	166	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL08197.1	0.0	1	770	1	770
VCV23259.1	0.0	1	770	18	787
CBL12709.1	0.0	1	770	5	774
AEN95938.1	0.0	3	765	17	735
QBE96895.1	8.15e-271	15	759	8	705

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	1.96e-20	275	718	433	879	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
6GSZ_A	3.11e-07	163	689	256	742	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	2.31e-29	267	749	594	1106	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2
T2KNB2	1.79e-11	282	694	372	786	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000076_00840.