CAZyme Information: MGYG000000076_00862

Basic Information

• Species: Roseburia intestinalis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia intestinalis
• CAZyme ID: MGYG000000076_00862
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
568	MGYG000000076_5|CGC6	65311.43	4.6647

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000076	4318260	Isolate	United Kingdom	Europe

• Gene Location: Start: 166213; End: 167919 Strand: +

Full Sequence      

MRLNLREVPFSTRGSYMAFSYLEGKYQGKEVENGLYFRTVHGSASSSFLARVRPVYERKQ
IEYTYEAEPWELRIITDKGTARLVFADKDTIVIRGNLALEFDFMTEGTMYTFAQPWKSGD
KDFWMVNCFNGNSRYMVRAAKGTVRPEQKWSVSTAEYCRICLEPGNAGEYLATLEENFED
WADRKIEYDYDAILKEKAAEFERFYESMPSVPAVYADAARVAAYVDWASIVAPCGVLKRE
SMFMSKNWMCNVWSWDHCFNAMALAYHNPKEAWDQFLVMFDFQKPSGNIPDSVNDAKIIH
NYCKPPIHGWTLRKLMGIMAISHEQLMEAYEKLSKWTYWWLNCRDENGDGLCEYTHGNDS
GWDNATAFAELPPVTLPDLAAFLVLQMDVLAEVAEKLGYMSDADMWKERSDKMLDKMLQV
LFRDEKPIGLAGFDMTEVDCDSLILYLPIIIGKKLPEEIRRTMIETLKSEKFNTEYGLAT
ESPASSAYEPDGYWRGPIWAPSTMIVLDGMRECGEEEFVSEAVHKFCRMIQKSGCAENFD
ALTGEGLRDRAYTWTASVMLVMAHEYLV

Enzyme Prediction     

No EC number prediction in MGYG000000076_00862.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	179	567	6.1e-56	0.5052631578947369

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3408	GDB1	1.15e-18	248	560	281	600	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
PRK10137	PRK10137	8.05e-15	251	567	346	778	alpha-glucosidase; Provisional
pfam03200	Glyco_hydro_63	1.67e-07	326	563	188	493	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL12731.1	0.0	1	568	1	568
QBE95804.1	0.0	1	567	1	567
QHQ63144.1	1.50e-219	1	568	1	570
QBE97352.1	3.14e-210	1	568	2	574
AEE95252.1	2.58e-181	1	568	1	565

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WVA_A	2.97e-14	253	560	32	416	Crystalstructure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVA_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVB_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVB_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVC_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8],4WVC_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8]
2Z07_A	7.00e-14	253	560	32	416	Crystalstructure of uncharacterized conserved protein from Thermus thermophilus HB8 [Thermus thermophilus],2Z07_B Crystal structure of uncharacterized conserved protein from Thermus thermophilus HB8 [Thermus thermophilus]
3W7S_A	1.90e-10	226	566	293	756	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	7.56e-10	226	566	293	756	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	9.96e-10	226	566	293	756	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D8QTR2	1.22e-13	253	560	98	482	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	2.85e-13	253	560	98	482	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
P42592	1.05e-09	226	566	316	779	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000076_00862.