CAZyme Information: MGYG000000076_02173

Basic Information

• Species: Roseburia intestinalis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia intestinalis
• CAZyme ID: MGYG000000076_02173
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1093		125238.06	5.2252

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000076	4318260	Isolate	United Kingdom	Europe

• Gene Location: Start: 115037; End: 118318 Strand: +

Full Sequence      

MDSELYVNSRKVLEWKYGYSTFEADITDFLENGNNEIMVGVHVKHPNSRWYAGAGIYRNV
WLKTVHTEHLVSDGIYVSTEEQKDGYQVLVYVETSQAAGTEVQCNLEGIEKKLPIRRDGD
RAEFSFFLKNPKLWEPETPNLYMITVRLYKKGKLLEEEHVNFGCRTIETDPQQGFLLNHK
KRKLKGVCLHHNLGALGSAVKKDAIKRQLTLMKEMGADAIRTAHNMPAVELMELADEMGF
LIVSEAFDCWERPKNPYDYARFFTDWWKRDIASWVRRDRNHPSLIFWSIGNEIYDMHADE
RGQTFTRLLMEEVYRHDFKRNGRVTFGSNFMPWEKAQKCADIVKIAGYNYSEKYYEEHHR
EHPDWVIYGSETASTVQSRGVYHFPLKQSVLADVDEQCSALGNSTTSWGAKSAEACIIAE
REHPYSMGQFLWSGIDYIGEPTPYHTKNSYLGQVDTAGFPKDSYYIYQAEWVSFQRKPVL
HLFPYWDFNKDQTIDVRICSNASDVELFVNGVSKGRKQIDHLQGRKLTADYQVPYEEGEI
AAVAYDETGKEVLRECRHSFGDSAEIIVRCVKADGTEYQYYKVKPVVEENRRNKSLYFAT
AKYMEIWTNRKELLFLEIGMTDQEGNPVENANNRIKVKVTGEGRLIGLDNGDSTDYDSYK
GSSRKLFSGKLLAMIETSGREGIVQIELSEISQSEGVLQKENNAVSVEEERMSREENSPW
VRKIELICEEEKNFSEEHRQAIVGVKVLPKEAANRKIMCEITTNAGIPSDLAEMTEIPSN
ELSENERNDGIVKKICIRARGDGEFRLRACASNGQQQVKVISSYDFVAEGLGKMYFDPYK
LVAGGLYNDSVGDVGNGNEHGVSTARDGKTIVGFRGIDFGKIGSDSITLPIFELGGVETP
IGIWDGKPGEKESRLLITAVYQKASIWNTYQEETYLLPERLKGIHDLYFELHQKIHLKGF
VFRKYPKAFECLYANESEAIYGDQMRVTEKGVMDIGNNVTLEFSDMDFGSDGTDKICICG
RTQNEKNTIHIRFFDGEKENRQIIEFPQEDEFTMQEFKIESVFGLQQVSFIFMPGSQFDF
YSFQFLKKEGEEG

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	496	1.8e-87	0.5345744680851063

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.63e-57	1	601	110	753	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	4.85e-35	3	292	95	417	beta-D-glucuronidase; Provisional
PRK10340	ebgA	3.09e-28	4	325	140	483	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	8.23e-26	5	292	153	462	beta-galactosidase.
pfam18565	Glyco_hydro2_C5	1.40e-24	609	689	13	93	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VCV24074.1	0.0	1	1093	1	1093
ACX64938.1	0.0	1	1089	75	1153
QOT12659.1	0.0	1	1089	75	1153
AVV58790.1	0.0	1	1090	76	1155
AWP27978.1	0.0	1	1090	76	1155

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7CWD_A	1.39e-137	1	689	92	788	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	1.04e-133	1	689	98	794	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
4CU6_A	9.86e-126	1	682	102	824	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU7_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU8_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4]
4CUC_A	2.67e-125	1	682	102	824	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA. [Streptococcus pneumoniae TIGR4]
5T98_A	2.30e-113	2	677	113	794	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	2.37e-119	1	682	130	828	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	1.84e-74	1	670	134	788	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	3.50e-43	1	646	131	805	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	2.98e-30	3	647	86	695	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
Q56307	3.49e-25	5	295	142	444	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000076_02173.